PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Pahal.C00703.2

Organism

Panicum hallii

Taxonomic ID

206008

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum

Family

MIKC_MADS

Protein Properties

Length: 264aa MW: 29683.9 Da PI: 9.3196

Description

MIKC_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Pahal.C00703.2	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	96.4	1.2e-30	9	59	1	51
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krien++ rqvtf+kRrng+lKKA+ELSvLCdaeva+i+fss+g+lyeys+ Pahal.C00703.2 9 KRIENNTSRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYSN 59 79***********************************************95 PP
2	K-box	101.5	1.2e-33	82	175	8	100
K-box 8 s.leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkklee 100 le + ++++qqe+akL+++i++Lq+++Rhl+G+++e+LslkeL+qLe++Lek+++kiR++K+ell ++i+++ k+e elq+++++Lr+k+ee Pahal.C00703.2 82 PlLELNAQQYYQQESAKLRNQIQMLQNTNRHLVGDSVENLSLKELKQLESRLEKGISKIRARKSELLSAEINYMVKRETELQNDHMNLRTKIEE 175 45677889************************************************************************************97 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS50066	33.543	1	61	IPR002100	Transcription factor, MADS-box
SMART	SM00432	7.5E-41	1	60	IPR002100	Transcription factor, MADS-box
CDD	cd00265	7.79E-45	2	78	No hit	No description
SuperFamily	SSF55455	1.44E-32	2	75	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	6.5E-32	3	23	IPR002100	Transcription factor, MADS-box
PROSITE pattern	PS00350	0	3	57	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	1.6E-26	10	57	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	6.5E-32	23	38	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	6.5E-32	38	59	IPR002100	Transcription factor, MADS-box
Pfam	PF01486	3.4E-24	87	173	IPR002487	Transcription factor, K-box
PROSITE profile	PS51297	14.983	89	179	IPR002487	Transcription factor, K-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0048283	Biological Process	indeterminate inflorescence morphogenesis
GO:0048481	Biological Process	plant ovule development
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 264 aa Download sequence Send to blast
MGRGRIEIKR IENNTSRQVT FCKRRNGLLK KAYELSVLCD AEVALIVFSS RGRLYEYSNN 60 SVKATIERYK KAHAVGSSSG APLLELNAQQ YYQQESAKLR NQIQMLQNTN RHLVGDSVEN 120 LSLKELKQLE SRLEKGISKI RARKSELLSA EINYMVKRET ELQNDHMNLR TKIEEGEQQL 180 QQVTVARSAA VAAASAELNP FFQMDTKCFF PAGPFAGLDM KCFFPGGLQM LEAHRQILTT 240 ELNLGYQLAP PSGDDGINNP HQF*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1tqe_P	3e-19	1	69	1	69	Myocyte-specific enhancer factor 2B
1tqe_Q	3e-19	1	69	1	69	Myocyte-specific enhancer factor 2B
1tqe_R	3e-19	1	69	1	69	Myocyte-specific enhancer factor 2B
1tqe_S	3e-19	1	69	1	69	Myocyte-specific enhancer factor 2B
5f28_A	3e-19	1	69	1	69	MEF2C
5f28_B	3e-19	1	69	1	69	MEF2C
5f28_C	3e-19	1	69	1	69	MEF2C
5f28_D	3e-19	1	69	1	69	MEF2C
6c9l_A	3e-19	1	69	1	69	Myocyte-specific enhancer factor 2B
6c9l_B	3e-19	1	69	1	69	Myocyte-specific enhancer factor 2B
6c9l_C	3e-19	1	69	1	69	Myocyte-specific enhancer factor 2B
6c9l_D	3e-19	1	69	1	69	Myocyte-specific enhancer factor 2B
6c9l_E	3e-19	1	69	1	69	Myocyte-specific enhancer factor 2B
6c9l_F	3e-19	1	69	1	69	Myocyte-specific enhancer factor 2B
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor.

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	ZMU31522	0.0	U31522.1 Zea Mays MADS box protein (ZmOV23) mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_025807446.1	0.0	MADS-box transcription factor 13-like
Swissprot	Q2QW53	1e-125	MAD13_ORYSJ; MADS-box transcription factor 13
TrEMBL	A0A2T7E618	0.0	A0A2T7E618_9POAL; Uncharacterized protein
STRING	Pavir.Cb01898.1.p	0.0	(Panicum virgatum)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G09960.1	4e-81	MIKC_MADS family protein

Link Out ? help Back to Top
Phytozome	Pahal.C00703.2

Publications ? help Back to Top
Gindullis F,Rose A,Patel S,Meier I Four signature motifs define the first class of structurally related large coiled-coil proteins in plants. BMC Genomics, 2002. 3: p. 9 [PMID:11972898] Kikuchi S, et al. Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice. Science, 2003. 301(5631): p. 376-9 [PMID:12869764] Yamaki S,Satoh H,Nagato Y Gypsy embryo specifies ovule curvature by regulating ovule/integument development in rice. Planta, 2005. 222(3): p. 408-17 [PMID:16001259] Dreni L, et al. The D-lineage MADS-box gene OsMADS13 controls ovule identity in rice. Plant J., 2007. 52(4): p. 690-9 [PMID:17877710] Yamaki S,Nagato Y,Kurata N,Nonomura K Ovule is a lateral organ finally differentiated from the terminating floral meristem in rice. Dev. Biol., 2011. 351(1): p. 208-16 [PMID:21146515] Li H,Liang W,Yin C,Zhu L,Zhang D Genetic interaction of OsMADS3, DROOPING LEAF, and OsMADS13 in specifying rice floral organ identities and meristem determinacy. Plant Physiol., 2011. 156(1): p. 263-74 [PMID:21444646] Li H, et al. Rice MADS6 interacts with the floral homeotic genes SUPERWOMAN1, MADS3, MADS58, MADS13, and DROOPING LEAF in specifying floral organ identities and meristem fate. Plant Cell, 2011. 23(7): p. 2536-52 [PMID:21784949]