PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Pahal.B00412.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
|
||||||||
Family | FAR1 | ||||||||
Protein Properties | Length: 68aa MW: 7977.86 Da PI: 10.0732 | ||||||||
Description | FAR1 family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | FAR1 | 41.6 | 4.1e-13 | 11 | 62 | 1 | 53 |
FAR1 1 kfYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerr 53 +fYn+YA+ GFs+ +s+s++ k++ +i +rtf+Cs+ g r +++++ e+++ Pahal.B00412.1 11 DFYNFYARVKGFSIPRSSSHNVKNTITINNRTFCCSRPGIRGPNTRE-ESSKY 62 6******************************************9998.44333 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF03101 | 6.0E-10 | 11 | 66 | IPR004330 | FAR1 DNA binding domain |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 68 aa Download sequence Send to blast |
MKFYAEQEAY DFYNFYARVK GFSIPRSSSH NVKNTITINN RTFCCSRPGI RGPNTREESS 60 KYSRPRSD |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_028549737.1 | 4e-15 | protein FAR1-RELATED SEQUENCE 7 isoform X3 | ||||
TrEMBL | A0A194YJR4 | 6e-24 | A0A194YJR4_SORBI; Uncharacterized protein | ||||
STRING | Pavir.Hb01264.1.p | 3e-33 | (Panicum virgatum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP18 | 32 | 967 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G22170.2 | 1e-06 | far-red elongated hypocotyls 3 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Pahal.B00412.1 |