PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Pahal.A01097.2 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
|
||||||||
Family | GATA | ||||||||
Protein Properties | Length: 154aa MW: 16928.3 Da PI: 10.2461 | ||||||||
Description | GATA family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | GATA | 56.8 | 3.1e-18 | 30 | 64 | 1 | 35 |
GATA 1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 C+ C+ttkTplWR gp g+ +LCnaCG++yrkk++ Pahal.A01097.2 30 CTECHTTKTPLWRGGPCGPMSLCNACGIRYRKKRR 64 ********************************986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF57716 | 9.5E-14 | 23 | 63 | No hit | No description |
SMART | SM00401 | 8.1E-15 | 24 | 76 | IPR000679 | Zinc finger, GATA-type |
PROSITE profile | PS50114 | 12.571 | 24 | 60 | IPR000679 | Zinc finger, GATA-type |
Gene3D | G3DSA:3.30.50.10 | 2.9E-14 | 28 | 64 | IPR013088 | Zinc finger, NHR/GATA-type |
CDD | cd00202 | 3.92E-14 | 29 | 64 | No hit | No description |
Pfam | PF00320 | 5.3E-16 | 30 | 64 | IPR000679 | Zinc finger, GATA-type |
PROSITE pattern | PS00344 | 0 | 30 | 55 | IPR000679 | Zinc finger, GATA-type |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0008270 | Molecular Function | zinc ion binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 154 aa Download sequence Send to blast |
MAPEMDSSVE KGSGSPDPDE RPASGEPKAC TECHTTKTPL WRGGPCGPMS LCNACGIRYR 60 KKRREALGLD ANKSGGAEQQ QQQQRKKKAA AASKREREKE AEADEVTVEL RTVGFGKEVV 120 LKQRRRMRRR RRLGEEERAA ILLMALSSGV VYA* |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 122 | 128 | QRRRMRR |
2 | 124 | 129 | RRMRRR |
3 | 124 | 131 | RRMRRRRR |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | FP100003 | 5e-74 | FP100003.1 Phyllostachys edulis cDNA clone: bphyst005b14, full insert sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_025794900.1 | 1e-107 | GATA transcription factor 16-like isoform X2 | ||||
TrEMBL | A0A2S3IGF1 | 1e-106 | A0A2S3IGF1_9POAL; Uncharacterized protein | ||||
STRING | Pavir.J03766.1.p | 2e-84 | (Panicum virgatum) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G06740.1 | 1e-18 | GATA transcription factor 15 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Pahal.A01097.2 |