PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Pahal.A01097.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
|
||||||||
Family | GATA | ||||||||
Protein Properties | Length: 155aa MW: 17056.4 Da PI: 10.2461 | ||||||||
Description | GATA family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | GATA | 56.7 | 3.2e-18 | 31 | 65 | 1 | 35 |
GATA 1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 C+ C+ttkTplWR gp g+ +LCnaCG++yrkk++ Pahal.A01097.1 31 CTECHTTKTPLWRGGPCGPMSLCNACGIRYRKKRR 65 ********************************986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF57716 | 9.98E-14 | 24 | 64 | No hit | No description |
SMART | SM00401 | 8.1E-15 | 25 | 77 | IPR000679 | Zinc finger, GATA-type |
PROSITE profile | PS50114 | 12.571 | 25 | 61 | IPR000679 | Zinc finger, GATA-type |
Gene3D | G3DSA:3.30.50.10 | 2.9E-14 | 29 | 65 | IPR013088 | Zinc finger, NHR/GATA-type |
CDD | cd00202 | 3.75E-14 | 30 | 65 | No hit | No description |
PROSITE pattern | PS00344 | 0 | 31 | 56 | IPR000679 | Zinc finger, GATA-type |
Pfam | PF00320 | 5.3E-16 | 31 | 65 | IPR000679 | Zinc finger, GATA-type |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0008270 | Molecular Function | zinc ion binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 155 aa Download sequence Send to blast |
MAPEMDSSVE KQGSGSPDPD ERPASGEPKA CTECHTTKTP LWRGGPCGPM SLCNACGIRY 60 RKKRREALGL DANKSGGAEQ QQQQQRKKKA AAASKREREK EAEADEVTVE LRTVGFGKEV 120 VLKQRRRMRR RRRLGEEERA AILLMALSSG VVYA* |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 123 | 129 | QRRRMRR |
2 | 125 | 130 | RRMRRR |
3 | 125 | 132 | RRMRRRRR |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | FP100003 | 5e-68 | FP100003.1 Phyllostachys edulis cDNA clone: bphyst005b14, full insert sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_025794899.1 | 1e-108 | GATA transcription factor 16-like isoform X1 | ||||
TrEMBL | A0A2S3IGF5 | 1e-107 | A0A2S3IGF5_9POAL; Uncharacterized protein | ||||
STRING | Pavir.J03766.1.p | 5e-87 | (Panicum virgatum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP2418 | 38 | 92 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G06740.1 | 2e-18 | GATA transcription factor 15 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Pahal.A01097.1 |