PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Pgl017933

Organism

Picea glauca

Taxonomic ID

3330

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea

Family

NAC

Protein Properties

Length: 150aa MW: 17632 Da PI: 10.0847

Description

NAC family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
gnl\|UG\|Pgl#S55339908	PU_ref	Unigene	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NAM	177.8	3e-55	6	134	1	129
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkge 98 l+pGfrFhPtdeelv++yLk+kv+g+++++ ++i+e+d+yk+eP+dLp k ++++++ ewyfF ++d+ky++g+r+nr+tk+gyWk+tgkd++v+s ++ Pgl017933 6 LQPGFRFHPTDEELVSYYLKRKVRGQRFDF-NAISEIDLYKFEPRDLPgKsCLQSRDLEWYFFNPKDRKYPNGSRTNRSTKDGYWKTTGKDRPVCS-ASQ 103 679************************9.89***********6347778888**********************************.999 PP NAM 99 lvglkktLvfykgrapkgektdWvmheyrle 129 +vg+kktLv+++grap+ge+t+Wvmheyrle Pgl017933 104 TVGMKKTLVYHTGRAPRGERTNWVMHEYRLE 134 ***************************85 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF101941	1.28E-58	2	138	IPR003441	NAC domain
PROSITE profile	PS51005	54.039	6	150	IPR003441	NAC domain
Pfam	PF02365	2.1E-30	8	133	IPR003441	NAC domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 150 aa Download sequence Send to blast
MDQVSLQPGF RFHPTDEELV SYYLKRKVRG QRFDFNAISE IDLYKFEPRD LPGKSCLQSR 60 DLEWYFFNPK DRKYPNGSRT NRSTKDGYWK TTGKDRPVCS ASQTVGMKKT LVYHTGRAPR 120 GERTNWVMHE YRLEGKDLKM SNPAQVISII

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
3ulx_A	2e-55	3	133	12	140	Stress-induced transcription factor NAC1
Search in ModeBase

Expression -- Description ? help Back to Top
Source	Description
Uniprot	TISSUE SPECIFICITY: Expressed in root meristem (Ref.1). Expressed in roots, rosette leaves, cauline leaves, shoot apex, stems and flowers (PubMed:17158162). {ECO:0000269\|PubMed:17158162, ECO:0000269\|Ref.1}.

Functional Description ? help Back to Top
Source	Description
UniProt	Transcriptional activator activated by proteolytic cleavage through regulated intramembrane proteolysis (RIP) (By similarity). Transcripition activator associated with the induction of genes related to flavonoid biosynthesis and required for the accumulation of anthocyanins in response to high light stress (PubMed:19887540). Plays a role in the regulation of 20S and 26S proteasomes in response to high light stress (PubMed:21889048). {ECO:0000250\|UniProtKB:Q949N0, ECO:0000269\|PubMed:19887540, ECO:0000269\|PubMed:21889048}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By exposure to high light (PubMed:19887540). Induced by heat and methyl methanesulfonate (MMS) treatment (PubMed:17158162). {ECO:0000269\|PubMed:17158162, ECO:0000269\|PubMed:19887540}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_010270428.1	1e-67	PREDICTED: NAC domain-containing protein 37-like isoform X2
Refseq	XP_022893870.1	8e-68	NAC domain-containing protein 86-like isoform X2
Swissprot	Q84K00	6e-64	NAC78_ARATH; NAC domain-containing protein 78
TrEMBL	A9P1L9	1e-109	A9P1L9_PICSI; Uncharacterized protein
STRING	XP_010694972.1	7e-67	(Beta vulgaris)
STRING	XP_010270427.1	2e-66	(Nelumbo nucifera)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G17730.1	4e-67	NAC domain containing protein 57

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Liang M, et al. Subcellular Distribution of NTL Transcription Factors in Arabidopsis thaliana. Traffic, 2015. 16(10): p. 1062-74 [PMID:26201836] Xiao D, et al. SENESCENCE-SUPPRESSED PROTEIN PHOSPHATASE Directly Interacts with the Cytoplasmic Domain of SENESCENCE-ASSOCIATED RECEPTOR-LIKE KINASE and Negatively Regulates Leaf Senescence in Arabidopsis. Plant Physiol., 2015. 169(2): p. 1275-91 [PMID:26304848] Gladman NP,Marshall RS,Lee KH,Vierstra RD The Proteasome Stress Regulon Is Controlled by a Pair of NAC Transcription Factors in Arabidopsis. Plant Cell, 2016. 28(6): p. 1279-96 [PMID:27194708] Tang Y,Zhao CY,Tan ST,Xue HW Arabidopsis Type II Phosphatidylinositol 4-Kinase PI4Kγ5 Regulates Auxin Biosynthesis and Leaf Margin Development through Interacting with Membrane-Bound Transcription Factor ANAC078. PLoS Genet., 2016. 12(8): p. e1006252 [PMID:27529511]