PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Pgl013712 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 190aa MW: 21126.8 Da PI: 7.273 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 174.9 | 8e-55 | 35 | 130 | 2 | 97 |
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelegek 97 reqdr+lPianv+rimkk+lP+nakisk+ake++qecvsefisfvt+easdkc++ekrktingdd+lwa++tlGfe y+eplk+yl +yre+egek Pgl013712 35 REQDRLLPIANVGRIMKKTLPNNAKISKEAKEIMQECVSEFISFVTGEASDKCHKEKRKTINGDDILWAMTTLGFEVYAEPLKIYLDRYREVEGEK 130 89*******************************************************************************************996 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 4.6E-54 | 30 | 146 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 9.47E-41 | 37 | 145 | IPR009072 | Histone-fold |
Pfam | PF00808 | 3.2E-28 | 40 | 104 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 1.4E-20 | 68 | 86 | No hit | No description |
PROSITE pattern | PS00685 | 0 | 71 | 87 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
PRINTS | PR00615 | 1.4E-20 | 87 | 105 | No hit | No description |
PRINTS | PR00615 | 1.4E-20 | 106 | 124 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 190 aa Download sequence Send to blast |
MGDHSGGESS PHSDIESTGL HNTNNGSSSS QSVIREQDRL LPIANVGRIM KKTLPNNAKI 60 SKEAKEIMQE CVSEFISFVT GEASDKCHKE KRKTINGDDI LWAMTTLGFE VYAEPLKIYL 120 DRYREVEGEK LSLSKQLQAD QPQSEQHPAY NPAHNRPLVM TYKMPLPMPM HAKAPSPTDP 180 AATGHGRRPF |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4g91_B | 2e-48 | 34 | 125 | 1 | 92 | Transcription factor HapC (Eurofung) |
4g92_B | 2e-48 | 34 | 125 | 1 | 92 | Transcription factor HapC (Eurofung) |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Ubiquitous. {ECO:0000269|PubMed:11250072}. | |||||
Uniprot | TISSUE SPECIFICITY: Ubiquitous. Predominantly expressed in flowers and siliques. {ECO:0000269|PubMed:11250072, ECO:0000269|PubMed:9662544}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_024396797.1 | 3e-60 | nuclear transcription factor Y subunit B-3-like | ||||
Refseq | XP_024396798.1 | 3e-60 | nuclear transcription factor Y subunit B-3-like | ||||
Swissprot | O23310 | 7e-57 | NFYB3_ARATH; Nuclear transcription factor Y subunit B-3 | ||||
Swissprot | Q9FGJ3 | 8e-57 | NFYB2_ARATH; Nuclear transcription factor Y subunit B-2 | ||||
TrEMBL | H9MDE7 | 9e-68 | H9MDE7_PINRA; Uncharacterized protein (Fragment) | ||||
TrEMBL | H9VDK5 | 9e-68 | H9VDK5_PINTA; Uncharacterized protein (Fragment) | ||||
STRING | PP1S83_179V6.2 | 1e-59 | (Physcomitrella patens) | ||||
STRING | Bostr.14419s0057.1.p | 1e-59 | (Boechera stricta) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G14540.1 | 3e-59 | nuclear factor Y, subunit B3 |