PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pgl009884
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family TALE
Protein Properties Length: 393aa    MW: 43890.4 Da    PI: 4.9831
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Pgl#S55350997PU_unrefUnigeneView CDS
PUT-175a-Picea_glauca-1166PU_refplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox26.79.4e-093223542355
                SS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
   Homeobox  23 rypsaeereeLAkklgLterqVkvWFqNrRake 55 
                +yps++++  LA+++gL ++q+ +WF N+R ++
  Pgl009884 322 PYPSESQKIALAESTGLYQKQINNWFINQRKRH 354
                8*****************************885 PP

2ELK40.65.2e-14274295122
        ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                ELK+qLlrKYsgyL+sLkqEF+
  Pgl009884 274 ELKDQLLRKYSGYLSSLKQEFL 295
                9********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012552.1E-1897141IPR005540KNOX1
PfamPF037901.5E-2198140IPR005540KNOX1
SMARTSM012563.4E-24146197IPR005541KNOX2
PfamPF037913.8E-23149196IPR005541KNOX2
PfamPF037896.3E-11274295IPR005539ELK domain
SMARTSM011887.1E-8274295IPR005539ELK domain
PROSITE profilePS5121311.592274294IPR005539ELK domain
PROSITE profilePS5007112.325294357IPR001356Homeobox domain
SuperFamilySSF466894.71E-18296370IPR009057Homeodomain-like
SMARTSM003892.2E-12296361IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.603.0E-26299359IPR009057Homeodomain-like
CDDcd000863.83E-11306358No hitNo description
PfamPF059208.0E-16314353IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 393 aa     Download sequence    Send to blast
HFVMEQFIPE QAVISDSSIS SVKTEVCSGS GGTGVPGQFE LIRRKEEGRC ARAYAEPSFV  60
VTPLVTSLPP QQQEARMVTS LAVDMDSSCS CKPIEADAMK AKIIAHVHYP RLVAAYIDCQ  120
KVGAPPDVVS ELDELSQKCH AQQCVATISI GADPELDQFM EAYCEMFIKY QEELTKPFKE  180
AMAFLKKIEN QLGALTKGTI RTSSLDQGDE RGDGAASSEE DENQLGALTK GTIRTSSLDQ  240
GDERGDGAAS SEEEDGSGGE VEFHEVDPHA EDRELKDQLL RKYSGYLSSL KQEFLKKKKK  300
GKLPKEARQK LLDWWTRNYK WPYPSESQKI ALAESTGLYQ KQINNWFINQ RKRHWKPSEE  360
MQFVVMDSPN PHNAAFFLEG HLRTDGTAFS MDC
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pgl.62320.0stem
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in the vegetative meristem. Present in the base of flower primordia (PubMed:26390296). {ECO:0000269|PubMed:12900451, ECO:0000269|PubMed:26390296, ECO:0000269|PubMed:7866029}.
Functional Description ? help Back to Top
Source Description
UniProtMay play a role in meristem function, and may be involved in maintaining cells in an undifferentiated, meristematic state, and its expression disappears at the same time the shoot apex undergoes the transition from vegetative to reproductive development (PubMed:11934861). Positive regulator of LATERAL ORGAN BOUNDARIES (LOB) (PubMed:11934861). Probably binds to the DNA sequence 5'-TGAC-3' (PubMed:11934861). Able to traffic from the L1 to the L2/L3 layers of the meristem, presumably through plasmodesmata (PubMed:12900451). {ECO:0000269|PubMed:11934861, ECO:0000269|PubMed:12900451, ECO:0000269|PubMed:7866029}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Negatively regulated by ASYMMETRIC LEAVES1 (AS1) and ASYMMETRIC LEAVES2 (AS2).
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_022870905.11e-103homeotic protein knotted-1 isoform X1
SwissprotP466391e-103KNAT1_ARATH; Homeobox protein knotted-1-like 1
TrEMBLQ8GZN00.0Q8GZN0_PICAB; KNOTTED1-like homeodomain protein 2 (Fragment)
STRINGAT4G08150.11e-102(Arabidopsis thaliana)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G08150.11e-97KNOTTED-like from Arabidopsis thaliana
Publications ? help Back to Top
  1. dela Paz JS, et al.
    Chromosome fragile sites in Arabidopsis harbor matrix attachment regions that may be associated with ancestral chromosome rearrangement events.
    PLoS Genet., 2012. 8(12): p. e1003136
    [PMID:23284301]
  2. Liu C, et al.
    Phosphatidylserine synthase 1 is required for inflorescence meristem and organ development in Arabidopsis.
    J Integr Plant Biol, 2013. 55(8): p. 682-95
    [PMID:23931744]
  3. Liu B, et al.
    NEVERSHED and INFLORESCENCE DEFICIENT IN ABSCISSION are differentially required for cell expansion and cell separation during floral organ abscission in Arabidopsis thaliana.
    J. Exp. Bot., 2013. 64(17): p. 5345-57
    [PMID:23963677]
  4. Simonini S,Kater MM
    Class I BASIC PENTACYSTEINE factors regulate HOMEOBOX genes involved in meristem size maintenance.
    J. Exp. Bot., 2014. 65(6): p. 1455-65
    [PMID:24482368]
  5. Scofield S,Dewitte W,Murray JA
    STM sustains stem cell function in the Arabidopsis shoot apical meristem and controls KNOX gene expression independently of the transcriptional repressor AS1.
    Plant Signal Behav, 2018.
    [PMID:24776954]
  6. Lee JE,Lampugnani ER,Bacic A,Golz JF
    SEUSS and SEUSS-LIKE 2 coordinate auxin distribution and KNOXI activity during embryogenesis.
    Plant J., 2014. 80(1): p. 122-35
    [PMID:25060324]
  7. Rast-Somssich MI, et al.
    Alternate wiring of a KNOXI genetic network underlies differences in leaf development of A. thaliana and C. hirsuta.
    Genes Dev., 2015. 29(22): p. 2391-404
    [PMID:26588991]
  8. Duplat-Bermúdez L,Ruiz-Medrano R,Landsman D,Mariño-Ramírez L,Xoconostle-Cázares B
    Transcriptomic analysis of Arabidopsis overexpressing flowering locus T driven by a meristem-specific promoter that induces early flowering.
    Gene, 2016. 587(2): p. 120-31
    [PMID:27154816]
  9. Li Z, et al.
    Transcription factors AS1 and AS2 interact with LHP1 to repress KNOX genes in Arabidopsis.
    J Integr Plant Biol, 2016. 58(12): p. 959-970
    [PMID:27273574]
  10. Lozano-Sotomayor P, et al.
    Altered expression of the bZIP transcription factor DRINK ME affects growth and reproductive development in Arabidopsis thaliana.
    Plant J., 2016. 88(3): p. 437-451
    [PMID:27402171]
  11. Frangedakis E,Saint-Marcoux D,Moody LA,Rabbinowitsch E,Langdale JA
    Nonreciprocal complementation of KNOX gene function in land plants.
    New Phytol., 2017. 216(2): p. 591-604
    [PMID:27886385]
  12. Woerlen N, et al.
    Repression of BLADE-ON-PETIOLE genes by KNOX homeodomain protein BREVIPEDICELLUS is essential for differentiation of secondary xylem in Arabidopsis root.
    Planta, 2017. 245(6): p. 1079-1090
    [PMID:28204875]
  13. Douglas SJ,Li B,Kliebenstein DJ,Nambara E,Riggs CD
    A novel Filamentous Flower mutant suppresses brevipedicellus developmental defects and modulates glucosinolate and auxin levels.
    PLoS ONE, 2017. 12(5): p. e0177045
    [PMID:28493925]
  14. Wang X, et al.
    Overexpressed BRH1, a RING finger gene, alters rosette leaf shape in Arabidopsis thaliana.
    Sci China Life Sci, 2018. 61(1): p. 79-87
    [PMID:28887625]
  15. Simonini S,Stephenson P,Østergaard L
    A molecular framework controlling style morphology in Brassicaceae.
    Development, 2018.
    [PMID:29440299]
  16. Felipo-Benavent A, et al.
    Regulation of xylem fiber differentiation by gibberellins through DELLA-KNAT1 interaction.
    Development, 2019.
    [PMID:30389856]