PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pgl009693
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family TALE
Protein Properties Length: 419aa    MW: 47177.3 Da    PI: 8.8175
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Pgl#S40925915PU_unrefUnigeneView CDS
PUT-175a-Picea_glauca-36407PU_refplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox30.37.4e-101211581954
                HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
   Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                Fe   ++yp+ +++  LA+++gL+ +qV++WF N R +
  Pgl009693 121 FEHflHPYPTDADKHMLARQTGLSRSQVSNWFINARVR 158
                564459******************************88 PP

2BELL88.95.3e-293542172
       BELL 21 krYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72
               +rY qy+eq+++v+ sFe +aglg+a+pYt+lAlka+SrhF+cL+dai +q+
  Pgl009693  3 RRYGQYCEQMKMVVTSFESIAGLGAATPYTALALKAMSRHFKCLRDAINNQL 54
               8************************************************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005740.002252IPR006563POX domain
PfamPF075265.5E-24250IPR006563POX domain
PROSITE profilePS5007112.56899162IPR001356Homeobox domain
SMARTSM003891.8E-10102166IPR001356Homeobox domain
CDDcd000861.19E-12102163No hitNo description
SuperFamilySSF466898.98E-18104170IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.8E-29105168IPR009057Homeodomain-like
PfamPF059202.7E-19119158IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 419 aa     Download sequence    Send to blast
XHRRYGQYCE QMKMVVTSFE SIAGLGAATP YTALALKAMS RHFKCLRDAI NNQLRVTSKA  60
LGEDSSLAGV SKGETPRLRF IDQNIRQQRA VQHLGMLEQH AWRPQRGLPE RSVSVLRAWL  120
FEHFLHPYPT DADKHMLARQ TGLSRSQVSN WFINARVRLW KPMVEEMYLQ ESKVSSEMDI  180
TLKRKENVSR DKTECLGSEK NMNKHGKMML DGGSDKQSAS EGGGSKFEHG GSTSQTGQES  240
SGTAMSMPLE SQFRPAEKVD GMREVDMSAN RNVRETQSLS SVNVATIGVD RRLEETPGCQ  300
NFDHSTKRFR NDDRNKIQGF ENTIDFSSYN HSSAIGGRYS HEDFTPRQFG SAGVSLTLGL  360
RHSGGQEKYS NGLYLSRDDS APDSNHHYNI HDSHDQGYGS GFDAQDMQFR KHVGSQLMH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrs_A1e-16108165158Homeobox protein Meis1
4xrs_B1e-16108165158Homeobox protein Meis1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pgl.295470.0needle
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLQ7XA571e-156Q7XA57_GNEGN; Putative BEL1-like protein (Fragment)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G23760.33e-86BEL1-like homeodomain 4