PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|
TF ID | Pgl007854 | ||||||||||||
Organism | |||||||||||||
Taxonomic ID | |||||||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
|
||||||||||||
Family | MIKC_MADS | ||||||||||||
Protein Properties | Length: 171aa MW: 19185.2 Da PI: 8.6034 | ||||||||||||
Description | MIKC_MADS family protein | ||||||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 89 | 2.4e-28 | 9 | 56 | 1 | 48 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEE CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklye 48 k+ien+ rqvtf+kRr g++KKA+ELSvLCdaeva+i+fss+gklye Pgl007854 9 KKIENSVHRQVTFCKRRGGLMKKAYELSVLCDAEVALIVFSSRGKLYE 56 68*********************************************9 PP | |||||||
2 | K-box | 63.7 | 7e-22 | 63 | 130 | 33 | 100 |
K-box 33 reqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkklee 100 +++R l+Ge+L+s +++eL+qLe L+k+++++RskKnel+le+i++lq+ke+ l+ n++L+ kl+e Pgl007854 63 NSNRYLMGEGLGSVTFEELNQLECCLQKGINQVRSKKNELMLEEIKTLQNKEHTLRMSNMMLQGKLDE 130 5679***********************************************************99986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00432 | 2.0E-39 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 32.099 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 1.2E-28 | 1 | 62 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 3.93E-39 | 2 | 72 | No hit | No description |
PRINTS | PR00404 | 5.2E-30 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 2.5E-25 | 10 | 56 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 5.2E-30 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 5.2E-30 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS51297 | 11.691 | 44 | 134 | IPR002487 | Transcription factor, K-box |
Pfam | PF01486 | 7.6E-19 | 62 | 128 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 171 aa Download sequence Send to blast |
MGRGKIEIKK IENSVHRQVT FCKRRGGLMK KAYELSVLCD AEVALIVFSS RGKLYELGTS 60 NNNSNRYLMG EGLGSVTFEE LNQLECCLQK GINQVRSKKN ELMLEEIKTL QNKEHTLRMS 120 NMMLQGKLDE CTNGKGITSL LTHGFTTLLP NQHVPCGFDL STHSLSSNVE M |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5f28_A | 3e-19 | 1 | 61 | 1 | 61 | MEF2C |
5f28_B | 3e-19 | 1 | 61 | 1 | 61 | MEF2C |
5f28_C | 3e-19 | 1 | 61 | 1 | 61 | MEF2C |
5f28_D | 3e-19 | 1 | 61 | 1 | 61 | MEF2C |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Pgl.22614 | 0.0 | root |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in flowers and seeds (Ref.1). Expressed in endotesta cell layer of developing seeds (PubMed:28369525). {ECO:0000269|PubMed:28369525, ECO:0000269|Ref.1}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor involved in seed development. {ECO:0000269|PubMed:29853599}. | |||||
UniProt | Probable transcription factor involved in seed development (PubMed:21447172, Ref.1, PubMed:29853599). Plays a role in seed morphogenesis by promoting the correct development of endotesta cell layer, which directs the further development of the seed coat, the endosperm, and consequently the embryo (Ref.1, PubMed:29853599). {ECO:0000269|PubMed:21447172, ECO:0000269|PubMed:29853599, ECO:0000269|Ref.1}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010273432.1 | 2e-49 | PREDICTED: floral homeotic protein AGAMOUS isoform X1 | ||||
Refseq | XP_010273433.1 | 2e-49 | PREDICTED: floral homeotic protein AGAMOUS isoform X2 | ||||
Swissprot | A0A217EJJ0 | 1e-45 | AG11S_VITVI; Agamous-like MADS-box protein AGL11 | ||||
Swissprot | F6I457 | 1e-45 | AG11C_VITVI; Agamous-like MADS-box protein AGL11 | ||||
TrEMBL | S5MKD9 | 2e-99 | S5MKD9_PICAB; DAL5 protein (Fragment) | ||||
STRING | XP_010273432.1 | 8e-49 | (Nelumbo nucifera) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G58780.2 | 1e-48 | MIKC_MADS family protein |