PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pgl001412
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family TALE
Protein Properties Length: 771aa    MW: 84333.9 Da    PI: 6.9163
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Pgl#S55338478PU_unrefUnigeneView CDS
PUT-175a-Picea_glauca-32878PU_refplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox26.31.2e-084534901954
                HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
   Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                Fe   ++yp+ +++  LA++ gLt +qV++WF N R +
  Pgl001412 453 FEHflHPYPKDADKHMLARQAGLTRSQVSNWFINARVR 490
                554459******************************88 PP

2BELL1192.2e-38316387172
       BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                er+elq+kkakL+ +l+eVd++Y+qy++q+q+v+ssFe+v+g g+ak YtslAl +iSrhFrcL+dai++qi
  Pgl001412 316 ERRELQIKKAKLVAMLDEVDQKYRQYYQQMQIVVSSFETVTGFGTAKTYTSLALGTISRHFRCLRDAIVGQI 387
                799********************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005741.1E-56228385IPR006563POX domain
PfamPF075267.7E-48233384IPR006563POX domain
PROSITE profilePS5007111.872431494IPR001356Homeobox domain
CDDcd000862.87E-11434495No hitNo description
SMARTSM003894.5E-8434498IPR001356Homeobox domain
SuperFamilySSF466894.28E-16435501IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.6E-27437500IPR009057Homeodomain-like
PfamPF059202.0E-17451490IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 771 aa     Download sequence    Send to blast
XNTTGSSLAT HNFAGNGQQQ QHFIGITVPT ASPSQQSSVG AIENSSTKQQ SATSSLLTSR  60
LETHAYDSWQ CGGNELTFLQ TTDAASSNQS LCGQLNNSVS LGNPPVAERS QVGMRPPPMS  120
SIEGEQSGML PGGLRLQLDQ PTTATGQRQG LSLCLFPKHA STVQLPPFQN HSTELDINCP  180
GVAQTASEDN SFRIDRSARD GMMGGGFSNS LNSPGVSKQI HSSSSGVTGF PNVLRGSKFL  240
KAAQELLDEV VNLSKFGKSE SAKHHKSQTL FGTVADKENT AKEAGIKNGI TDTSAGFLNS  300
AEETNISHNT ELSMAERREL QIKKAKLVAM LDEVDQKYRQ YYQQMQIVVS SFETVTGFGT  360
AKTYTSLALG TISRHFRCLR DAIVGQICVS SKSLGEEDMA GNGKGETSRL RFVDQQLRQQ  420
RALQQLGMIQ QPAWRPQRGL PERAVSVLRA WLFEHFLHPY PKDADKHMLA RQAGLTRSQV  480
SNWFINARVR LWKPMVEEIY MEEMKEAELG HSSAEKDHKK SGDSKEDTKS EEGSENSQNS  540
EDQKHTKATH LDSNSQDVVC EQQNISVSSG LKSELSPDMR YGRSQAFSIE GLSNDELFHE  600
VRDEGVTPGK LKKARNGIEG STYHLSPNMS TAVDFKMERS CQNGKFNDER HSSENYILVH  660
SGMALADSSG SSGSYQIGCL NRYGQEAFTP KFSGSGGVSL XFGTSTLLMV YHYLELNKXC  720
ISSEGRNHGL GSVSHDYCNI SETAAAHAAN AYESINLENR KRFATHLLQT L
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrs_A2e-16440497158Homeobox protein Meis1
4xrs_B2e-16440497158Homeobox protein Meis1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pgl.31580.0needle
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A0C9RM180.0A0A0C9RM18_9SPER; TSA: Wollemia nobilis Ref_Wollemi_Transcript_11489_4138 transcribed RNA sequence
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G35940.31e-92BEL1-like homeodomain 1