PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | CCG033313.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 202aa MW: 23629.1 Da PI: 10.5668 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 93.5 | 9.9e-30 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krien ++rqvtfskRrng+lKKA+ELS+LCdaev++iifs+tgk+y ++s CCG033313.1 9 KRIENPTRRQVTFSKRRNGLLKKAFELSILCDAEVSLIIFSPTGKFYQFAS 59 79***********************************************86 PP | |||||||
2 | K-box | 69.5 | 1.1e-23 | 80 | 171 | 8 | 99 |
K-box 8 sleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkle 99 + +++ e +++e++ L+k i++ + ++Rh +Ged+e L +keL+qLe+qL+++++++RskK ++ eq++ l+ k++++qeen +L+k+l CCG033313.1 80 DSHTRSLEFWRREIEELQKTINETEAQLRHCIGEDIEMLGMKELKQLERQLKTGVERVRSKKLRIAAEQVNWLKGKQRSIQEENARLKKRLH 171 46778899********************************************************************************9986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50066 | 32.366 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
SMART | SM00432 | 1.1E-40 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 1.76E-39 | 2 | 76 | No hit | No description |
SuperFamily | SSF55455 | 3.53E-33 | 2 | 90 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 4.7E-30 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 1.9E-26 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 4.7E-30 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 4.7E-30 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF01486 | 7.3E-22 | 81 | 170 | IPR002487 | Transcription factor, K-box |
PROSITE profile | PS51297 | 12.715 | 86 | 176 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 202 aa Download sequence Send to blast |
MGRGKVELKR IENPTRRQVT FSKRRNGLLK KAFELSILCD AEVSLIIFSP TGKFYQFASH 60 EMERTIARYR SEAGLSGPND SHTRSLEFWR REIEELQKTI NETEAQLRHC IGEDIEMLGM 120 KELKQLERQL KTGVERVRSK KLRIAAEQVN WLKGKQRSIQ EENARLKKRL HELHDGNISS 180 RIWEPTARKA IQLRTIDDGS HH |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5f28_A | 1e-22 | 1 | 85 | 1 | 82 | MEF2C |
5f28_B | 1e-22 | 1 | 85 | 1 | 82 | MEF2C |
5f28_C | 1e-22 | 1 | 85 | 1 | 82 | MEF2C |
5f28_D | 1e-22 | 1 | 85 | 1 | 82 | MEF2C |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor that promotes early floral meristem identity in synergy with APETALA1, FRUITFULL and LEAFY. Is required subsequently for the transition of an inflorescence meristem into a floral meristem. Seems to be partially redundant to the function of APETALA1 (By similarity). {ECO:0000250}. | |||||
UniProt | Probable transcription factor that promotes early floral meristem identity in synergy with APETALA1, FRUITFULL and LEAFY. Is required subsequently for the transition of an inflorescence meristem into a floral meristem. Seems to be partially redundant to the function of APETALA1 (By similarity). {ECO:0000250}. | |||||
UniProt | Probable transcription factor that promotes early floral meristem identity in synergy with APETALA1, FRUITFULL and LEAFY. Is required subsequently for the transition of an inflorescence meristem into a floral meristem. Seems to be partially redundant to the function of APETALA1. {ECO:0000269|PubMed:10765981}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_011044117.1 | 1e-147 | PREDICTED: truncated transcription factor CAULIFLOWER D-like isoform X2 | ||||
Swissprot | Q6R4S3 | 4e-46 | CAL_BRARR; Transcription factor CAULIFLOWER | ||||
Swissprot | Q6R4S6 | 4e-46 | CAL_BRARC; Transcription factor CAULIFLOWER | ||||
Swissprot | Q9SBK9 | 5e-46 | CAL_BRARP; Transcription factor CAULIFLOWER | ||||
TrEMBL | B9I3T7 | 1e-137 | B9I3T7_POPTR; Uncharacterized protein | ||||
STRING | Gorai.007G043400.1 | 2e-83 | (Gossypium raimondii) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF119 | 33 | 360 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G26310.1 | 3e-48 | MIKC_MADS family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|