PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | CCG029837.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
|
||||||||
Family | ZF-HD | ||||||||
Protein Properties | Length: 130aa MW: 14227.9 Da PI: 8.0444 | ||||||||
Description | ZF-HD family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | ZF-HD_dimer | 102.9 | 2.1e-32 | 61 | 117 | 3 | 60 |
ZF-HD_dimer 3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreveee 60 +v+Y eClkNhA+s+Gg+avDGC+Efm++ geegta al+CaACgCHRn+HRreve+e CCG029837.1 61 NVKYGECLKNHAVSVGGYAVDGCREFMAN-GEEGTAGALTCAACGCHRNYHRREVETE 117 799*************************8.999*********************9986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
ProDom | PD125774 | 3.0E-18 | 57 | 127 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
Pfam | PF04770 | 3.8E-30 | 61 | 114 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
TIGRFAMs | TIGR01566 | 1.1E-25 | 63 | 114 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
PROSITE profile | PS51523 | 25.362 | 64 | 113 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 130 aa Download sequence Send to blast |
MPASNYRPVF QLESSSLVYQ GFERGKGSVE LGSSMMRKRQ VVVRRMEEPS RSSTTSFTIR 60 NVKYGECLKN HAVSVGGYAV DGCREFMANG EEGTAGALTC AACGCHRNYH RREVETEVVC 120 DCSSPSSNGN |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Inhibits zinc finger homeodomain (ZHD) transcription factors by interacting with them to prevent both their nuclear localization and their DNA-binding properties. Involved in integrating signals from multiple hormones by regulating the expression of specific genes. {ECO:0000269|PubMed:21455630}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_011010640.1 | 7e-92 | PREDICTED: mini zinc finger protein 2-like | ||||
Swissprot | Q9LJW5 | 1e-41 | MIF2_ARATH; Mini zinc finger protein 2 | ||||
TrEMBL | B9H0F7 | 4e-83 | B9H0F7_POPTR; ZF-HD family protein | ||||
STRING | POPTR_0004s12510.1 | 6e-84 | (Populus trichocarpa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF1550 | 34 | 100 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G28917.1 | 3e-27 | mini zinc finger 2 |
Publications ? help Back to Top | |||
---|---|---|---|
|