PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CCG029666.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family Nin-like
Protein Properties Length: 1004aa    MW: 110522 Da    PI: 5.8795
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CCG029666.1genomeLZUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK89.33.1e-28592643152
       RWP-RK   1 aekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                  aek isle+l++yF +++kdAA +Lgvc+T++KriCRq+GI+RWP+Rkik++
  CCG029666.1 592 AEKMISLEVLQQYFTGSLKDAAMSLGVCPTTMKRICRQHGISRWPSRKIKKV 643
                  5899**********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.587578663IPR003035RWP-RK domain
PfamPF020424.1E-25596643IPR003035RWP-RK domain
SuperFamilySSF542772.19E-21901992No hitNo description
PROSITE profilePS5174522.609908990IPR000270PB1 domain
SMARTSM006661.8E-24908990IPR000270PB1 domain
Gene3DG3DSA:3.10.20.2401.7E-25908990No hitNo description
CDDcd064078.79E-36909989No hitNo description
PfamPF005645.4E-17909989IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 1004 aa     Download sequence    Send to blast
MPEPTEVGGG GESEGRKSME LDLDLDSSWP LEQISFISSN PMSPFLISSS NEQPCSPLWA  60
FSDAADDRLL AAAGAAAGQA SSSLVGGLRL SDNPIVLTCN PNSVTESKGE NDDNSKLPSP  120
FLGLWPIDNP DGYCIIKERM TRALRHFKES TEQHILAQVW APVKNGGRYA LTTSGQPFVI  180
DPHSNGLHQY RMVSLMYKFS VDGESDGELG LPGRVFRQKL PEWTPNVQYY SSKEYPRLDH  240
AIHYNVRGTV ALPVFEPSGQ SCVGVVELIM NSHKINYAPE VDKVCKALEA VDLKSSEILD  300
PPSTQICNEG RQNALAEILE ILTMVCETHK LPLAQTWVPC MHRSVLAYGG GLKKSCTSFD  360
GSCNGQVCMS TTDVAFYVVD AHMWGFREAC LEHHLQKGQG VAGRAFFSHN LCFCPDITQF  420
RKTEYPLVHY ARMFGLTSCF AICLRSSYTG DDDYILEFFL PPSITDSREW KTLLGSILAI  480
MKQDFQSLKV ASGMELEEEE GFVEMIQVST NGRLDLGLEC IQIPQSTKSP PDDNALLNGP  540
IVQIYPEKNQ LMFDLDVIKN GGSAVQADVT QTHASLTEKE TKMPKERKRG KAEKMISLEV  600
LQQYFTGSLK DAAMSLGVCP TTMKRICRQH GISRWPSRKI KKVNRSLSKL KRVIESVQGT  660
EGAFSFRTHQ TPLTTSSLPV ADGTISWPPN LNESNQQNSP NSKSPEHQGD KNGSPTCRTP  720
GSDVKAVFED QLLGCRKLSL EELTVQNRFS PELGKCSNRS KTRGGSRDES AGTPTSHGSC  780
QGCPENESAP AKDPSVSPVH KRGVKAGGSK KLALQQTREL NLSAAYSIPN AFFAAEAQEQ  840
FGGMLIEDTG SSKDLSNLCP AMADAIVVER VPESKWTDPL CSDINPTQMI AALSIAMPHV  900
TSRQEMNSVT IKATYREDKI RFRISLSSGI AELKEEVAKR LRLEVGTFDI KYLDDDHEWV  960
LIARDADLHE CMDVSRSSNS NMIRVSVHDT NANLGSSCES TWEI
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor involved in regulation of nitrate assimilation and in transduction of the nitrate signal. {ECO:0000269|PubMed:18826430}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Not regulated by the N source or by nitrate. {ECO:0000269|PubMed:18826430}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011026836.10.0PREDICTED: protein NLP7-like isoform X2
SwissprotQ84TH90.0NLP7_ARATH; Protein NLP7
TrEMBLA0A2K2BUQ70.0A0A2K2BUQ7_POPTR; Uncharacterized protein
STRINGPOPTR_0001s10970.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF42573456
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24020.10.0NIN like protein 7
Publications ? help Back to Top
  1. Xu N, et al.
    The Arabidopsis NRG2 Protein Mediates Nitrate Signaling and Interacts with and Regulates Key Nitrate Regulators.
    Plant Cell, 2016. 28(2): p. 485-504
    [PMID:26744214]
  2. Karve R,Suárez-Román F,Iyer-Pascuzzi AS
    The Transcription Factor NIN-LIKE PROTEIN7 Controls Border-Like Cell Release.
    Plant Physiol., 2016. 171(3): p. 2101-11
    [PMID:27221617]
  3. Yu LH, et al.
    Overexpression of Arabidopsis NLP7 improves plant growth under both nitrogen-limiting and -sufficient conditions by enhancing nitrogen and carbon assimilation.
    Sci Rep, 2016. 6: p. 27795
    [PMID:27293103]
  4. Menz J,Li Z,Schulze WX,Ludewig U
    Early nitrogen-deprivation responses in Arabidopsis roots reveal distinct differences on transcriptome and (phospho-) proteome levels between nitrate and ammonium nutrition.
    Plant J., 2016. 88(5): p. 717-734
    [PMID:27419465]
  5. Yan D, et al.
    NIN-like protein 8 is a master regulator of nitrate-promoted seed germination in Arabidopsis.
    Nat Commun, 2016. 7: p. 13179
    [PMID:27731416]
  6. Guan P, et al.
    Interacting TCP and NLP transcription factors control plant responses to nitrate availability.
    Proc. Natl. Acad. Sci. U.S.A., 2017. 114(9): p. 2419-2424
    [PMID:28202720]
  7. Liu KH, et al.
    Discovery of nitrate-CPK-NLP signalling in central nutrient-growth networks.
    Nature, 2017. 545(7654): p. 311-316
    [PMID:28489820]
  8. Li Z, et al.
    The Arabidopsis CPSF30-L gene plays an essential role in nitrate signaling and regulates the nitrate transceptor gene NRT1.1.
    New Phytol., 2017. 216(4): p. 1205-1222
    [PMID:28850721]
  9. Cao H, et al.
    Overexpression of the Maize ZmNLP6 and ZmNLP8 Can Complement the Arabidopsis Nitrate Regulatory Mutant nlp7 by Restoring Nitrate Signaling and Assimilation.
    Front Plant Sci, 2017. 8: p. 1703
    [PMID:29051766]
  10. Konishi N,Okubo T,Yamaya T,Hayakawa T,Minamisawa K
    Nitrate Supply-Dependent Shifts in Communities of Root-Associated Bacteria in Arabidopsis.
    Microbes Environ., 2017. 32(4): p. 314-323
    [PMID:29187692]
  11. Karve RA,Iyer-Pascuzzi AS
    Further insights into the role of NIN-LIKE PROTEIN 7 (NLP7) in root cap cell release.
    Plant Signal Behav, 2018. 13(1): p. e1414122
    [PMID:29215953]
  12. Zhao L, et al.
    The Arabidopsis NLP7 gene regulates nitrate signaling via NRT1.1-dependent pathway in the presence of ammonium.
    Sci Rep, 2018. 8(1): p. 1487
    [PMID:29367694]