PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CCG028138.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family Nin-like
Protein Properties Length: 958aa    MW: 106451 Da    PI: 7.1118
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CCG028138.1genomeLZUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK90.41.4e-28627677252
       RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                  ek+isle+l+++F++++kdAAk++gvc+T+LKriCRq+GI RWP+Rkik++
  CCG028138.1 627 EKTISLEVLRQHFAGSLKDAAKSIGVCPTTLKRICRQHGITRWPSRKIKKV 677
                  79***********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.041616697IPR003035RWP-RK domain
PfamPF020424.0E-25629677IPR003035RWP-RK domain
SuperFamilySSF542772.68E-22840935No hitNo description
Gene3DG3DSA:3.10.20.2402.1E-22848930No hitNo description
PROSITE profilePS5174522.491849932IPR000270PB1 domain
SMARTSM006661.0E-23849932IPR000270PB1 domain
PfamPF005642.5E-15850931IPR000270PB1 domain
CDDcd064079.01E-43850931No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 958 aa     Download sequence    Send to blast
MDDGNGPNFI PDSAFENFSG TSMDLDFMDE LLYEGCWLET ANEFNFLQAG TISSSDLNDP  60
RQYFPLFEPN SSNSNVNSHQ ENYQGVDELG GIGSQNQNIR SLDQSGSFPD ESNELGRRLW  120
IAPTATGPSS PVRDRLMHAI GQVKECTKDR DVLIQIWVPV KKEGKNVLTT IGQPYLLDRK  180
CQSLASYRNV SKDFQFPADE DSKELVGLPG RVFLRELPEW TPDVRFFRGV EYLRKSHAKQ  240
LNIRGSLAVP VFERGSRTCL GVIEVVTTTR DISYRPDLEN VCKALEAVDL RSPQDFCPPR  300
LKASGCCITS TRDLKVCKEV CQAAAPEISK ILESVCKAHR LPLALAWAPC FREGKGGCRH  360
FDESYSYFIS LVNSAYFVAE RDDWGFYMAC SEQYLSFGQG IVGRAFATNK QCLSTDVAAF  420
SKTDYPLSHH AKMFGLHAAI AIPLQSSYAG SADFVLELFL PKDCRNTEEQ KQMSDILPIT  480
VQQACQSWHV IMDKELEETV NKKMVVASDE RFHKDESQKF ASSLFKDSSK AESSWIARTV  540
EAQQKGKGVS VSWDHTKEEP REEFKVKSQR GRTQDDRYHK QAFPAFGQFQ QNSGPKSSIE  600
AGTDSSSAGR HSLGSIKFGD KRRTKTEKTI SLEVLRQHFA GSLKDAAKSI GVCPTTLKRI  660
CRQHGITRWP SRKIKKVGHS LKKLQLVIDS VQGAEGAIQM GSFYATFPEL TSPNLSGNGG  720
LPSTKTDENF KQLNPQPESG IFSAAPSALK SRSSSWSHSS GSSICCSIGV KQDTTTNNGS  780
VSGDPLMIED HGDVLKRTHS DAELHALSRD ETKCLVRSQS HKTFGDLPSP KTLPPLPKSS  840
SRVIRDGGGF RVKATFGADK IRFTLQPNWG FRDLQQETAR RFNLDDISGI DLKYLDDDQE  900
WVLLTCDADL EECRDVYKLS EIHTIKISLH QPAQPHLGSS MESRGPHLGS SLGTGVPF
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011040794.10.0PREDICTED: protein NLP2-like isoform X2
SwissprotQ7X9B90.0NLP2_ARATH; Protein NLP2
TrEMBLU5GKC20.0U5GKC2_POPTR; Uncharacterized protein
STRINGPOPTR_0004s21550.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF12373399
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35270.10.0Nin-like family protein