PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | CCG024144.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 150aa MW: 16547.5 Da PI: 5.3717 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 167.9 | 1.2e-52 | 19 | 113 | 3 | 97 |
NF-YB 3 eqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelegek 97 eqd++lPianv+rimk++lP nakisk+aket+qec+sefisfvt+eas+kc++e+rkt+ngdd++wa++ lGf+dy+ pl+ yl++yre+eg++ CCG024144.1 19 EQDKLLPIANVGRIMKQILPPNAKISKEAKETMQECASEFISFVTGEASEKCRKERRKTVNGDDVCWAMGALGFDDYAGPLRRYLQRYREIEGDR 113 8********************************************************************************************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 2.5E-50 | 18 | 134 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 4.03E-39 | 20 | 130 | IPR009072 | Histone-fold |
Pfam | PF00808 | 5.7E-27 | 24 | 87 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 1.4E-16 | 51 | 69 | No hit | No description |
PROSITE pattern | PS00685 | 0 | 54 | 70 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
PRINTS | PR00615 | 1.4E-16 | 70 | 88 | No hit | No description |
PRINTS | PR00615 | 1.4E-16 | 89 | 107 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 150 aa Download sequence Send to blast |
MVDNVGAGAS SDDGGVKLEQ DKLLPIANVG RIMKQILPPN AKISKEAKET MQECASEFIS 60 FVTGEASEKC RKERRKTVNG DDVCWAMGAL GFDDYAGPLR RYLQRYREIE GDRANQEKPA 120 NTNNTSIADQ EKEAPPSSSS SYRTNQGIRM |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4g91_B | 4e-42 | 19 | 108 | 3 | 92 | Transcription factor HapC (Eurofung) |
4g92_B | 4e-42 | 19 | 108 | 3 | 92 | Transcription factor HapC (Eurofung) |
5g49_A | 5e-42 | 19 | 108 | 8 | 97 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT B-6 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_011008710.1 | 1e-109 | PREDICTED: nuclear transcription factor Y subunit B-5-like | ||||
Swissprot | O82248 | 3e-55 | NFYB5_ARATH; Nuclear transcription factor Y subunit B-5 | ||||
TrEMBL | A0A2K1ZLA2 | 1e-105 | A0A2K1ZLA2_POPTR; Uncharacterized protein | ||||
STRING | POPTR_0008s22520.1 | 1e-105 | (Populus trichocarpa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF805 | 32 | 131 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G47810.1 | 1e-57 | nuclear factor Y, subunit B5 |
Publications ? help Back to Top | |||
---|---|---|---|
|