PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | CCG023421.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 176aa MW: 18955 Da PI: 7.557 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 180.9 | 1.1e-56 | 27 | 121 | 1 | 95 |
NF-YB 1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyreleg 95 vreqdrflPian+srimkk+lPan+ki+kdaketvqecvsefisf+tseasdkcqrekrktingddllwa+atlGfedy++plk+yl++yre ++ CCG023421.1 27 VREQDRFLPIANISRIMKKALPANGKIAKDAKETVQECVSEFISFITSEASDKCQREKRKTINGDDLLWAMATLGFEDYIDPLKIYLSRYREGDT 121 69*****************************************************************************************9665 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 5.1E-54 | 23 | 134 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 4.81E-40 | 30 | 131 | IPR009072 | Histone-fold |
Pfam | PF00808 | 2.1E-28 | 33 | 97 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 1.1E-20 | 61 | 79 | No hit | No description |
PROSITE pattern | PS00685 | 0 | 64 | 80 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
PRINTS | PR00615 | 1.1E-20 | 80 | 98 | No hit | No description |
PRINTS | PR00615 | 1.1E-20 | 99 | 117 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 176 aa Download sequence Send to blast |
MAAEAPASPG GGSHESGDQS PRSNSNVREQ DRFLPIANIS RIMKKALPAN GKIAKDAKET 60 VQECVSEFIS FITSEASDKC QREKRKTING DDLLWAMATL GFEDYIDPLK IYLSRYREGD 120 TKGSAKAGDT SAKKDVHPGP NAQISHQGSF SQGVSYGNSN SQVSPLPLSH THSTVC |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4g91_B | 2e-48 | 27 | 118 | 1 | 92 | Transcription factor HapC (Eurofung) |
4g92_B | 2e-48 | 27 | 118 | 1 | 92 | Transcription factor HapC (Eurofung) |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_011006932.1 | 1e-116 | PREDICTED: nuclear transcription factor Y subunit B-10-like isoform X1 | ||||
Refseq | XP_011048402.1 | 1e-116 | PREDICTED: nuclear transcription factor Y subunit B-10-like isoform X1 | ||||
Swissprot | Q8VYK4 | 7e-80 | NFYB8_ARATH; Nuclear transcription factor Y subunit B-8 | ||||
TrEMBL | B9IIZ5 | 1e-114 | B9IIZ5_POPTR; Uncharacterized protein | ||||
STRING | XP_006480596.1 | 1e-101 | (Citrus sinensis) | ||||
STRING | Gorai.007G374600.1 | 1e-101 | (Gossypium raimondii) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF2545 | 33 | 82 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G53340.1 | 1e-80 | nuclear factor Y, subunit B10 |
Publications ? help Back to Top | |||
---|---|---|---|
|