PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | CCG019325.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
|
||||||||
Family | BES1 | ||||||||
Protein Properties | Length: 163aa MW: 18612.8 Da PI: 8.0795 | ||||||||
Description | BES1 family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | DUF822 | 120.9 | 1.8e-37 | 34 | 122 | 3 | 91 |
DUF822 3 sgrkptwkErEnnkrRERrRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyrkgskpleeaeaagssasaspe 91 + r p+ +Er n++RERrRRa+a ki+ GLR++Gnyklpk+aD n+ l+ALc+eAGw ve+DGt r + + +++ + ss +a pe CCG019325.1 34 KLRYPSDRERQTNQQRERRRRAVAKKIFEGLRKHGNYKLPKHADSNDLLRALCEEAGWHVEEDGTICRMVLHNPYHEANVASSYDAPPE 122 6799****************************************************************887777344444444443333 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF05687 | 1.6E-33 | 35 | 113 | IPR008540 | BES1/BZR1 plant transcription factor, N-terminal |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 163 aa Download sequence Send to blast |
MVDEKRVVLS GCIKTSRGPW RVHRATKDGC IVTKLRYPSD RERQTNQQRE RRRRAVAKKI 60 FEGLRKHGNY KLPKHADSND LLRALCEEAG WHVEEDGTIC RMVLHNPYHE ANVASSYDAP 120 PEDHNYCTCN NHLDSEYGAF PLSTNSPIQE CHGGNDVNLT LSL |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5zd4_A | 1e-13 | 36 | 101 | 372 | 437 | Maltose-binding periplasmic protein,Protein BRASSINAZOLE-RESISTANT 1 |
5zd4_B | 1e-13 | 36 | 101 | 372 | 437 | Maltose-binding periplasmic protein,Protein BRASSINAZOLE-RESISTANT 1 |
5zd4_C | 1e-13 | 36 | 101 | 372 | 437 | Maltose-binding periplasmic protein,Protein BRASSINAZOLE-RESISTANT 1 |
5zd4_D | 1e-13 | 36 | 101 | 372 | 437 | Maltose-binding periplasmic protein,Protein BRASSINAZOLE-RESISTANT 1 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Positive regulator of brassinosteroid (BR) signaling. Transcription factor that activates target gene expression by binding specifically to the DNA sequence 5'-CANNTG-3'(E box) through its N-terminal domain. Can bind individually to the promoter as a homodimer or synergistically as a heterodimer with BIM1, BIM2 or BIM3. The C-terminal domain is probably involved in transcriptional activation (PubMed:12007405, PubMed:15680330, PubMed:18467490, PubMed:19170933). Recruits the transcription elongation factor IWS1 to control BR-regulated gene expression (PubMed:20139304). Forms a trimeric complex with IWS1 and ASHH2/SDG8 to regulate BR-regulated gene expression (PubMed:24838002). Promotes quiescent center (QC) self-renewal by cell divisions in the primary root. Binds to the E-boxes of the BRAVO promoter to repress its expression (PubMed:24981610). {ECO:0000269|PubMed:12007405, ECO:0000269|PubMed:15680330, ECO:0000269|PubMed:18467490, ECO:0000269|PubMed:19170933, ECO:0000269|PubMed:20139304, ECO:0000269|PubMed:24838002, ECO:0000269|PubMed:24981610}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_011046810.1 | 1e-121 | PREDICTED: protein BRASSINAZOLE-RESISTANT 2-like | ||||
Swissprot | Q9LN63 | 5e-16 | BZR2_ARATH; Protein BRASSINAZOLE-RESISTANT 2 | ||||
TrEMBL | B9IGH5 | 1e-113 | B9IGH5_POPTR; Uncharacterized protein | ||||
STRING | POPTR_0016s13350.1 | 1e-114 | (Populus trichocarpa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF15152 | 11 | 13 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G19350.6 | 3e-18 | BES1 family protein |