PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CCG017901.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family Nin-like
Protein Properties Length: 274aa    MW: 30329 Da    PI: 9.7922
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CCG017901.1genomeLZUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK68.41e-211758748
       RWP-RK  7 ledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRk 48
                  e +sk+Fslp+ dAA++Lgvc++vLK+iCR++G++RWP+Rk
  CCG017901.1 17 WEAISKHFSLPLSDAANNLGVCVSVLKKICRENGLDRWPYRK 58
                 689**************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151915.073181IPR003035RWP-RK domain
PfamPF020422.0E-201758IPR003035RWP-RK domain
Sequence ? help Back to Top
Protein Sequence    Length: 274 aa     Download sequence    Send to blast
MNIQQQQQSN QSKPPSWEAI SKHFSLPLSD AANNLGVCVS VLKKICRENG LDRWPYRKYL  60
AGKSIEDIRR YAAREKIKAI ADLAKAANKS GIQQQNNENS KPHKLQQQGT KDVLVGRQHI  120
TLTSGLAKGL MGLDEFKYGF PSDGLSTATN KWWGSSLSDT QRATDRAGTE TDEDDGHQSE  180
EKADAGTSVV IVDEEKGENG KMESNEIDPQ GTGLLTSVRK RAVEEGREAL KLGVYRAYGV  240
NKLGRKQRAL LLRIFGSSLP KQWIQDFSSN RVGL
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF1485940.0EF148594.1 Populus trichocarpa x Populus deltoides clone WS0134_I13 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011026245.10.0PREDICTED: uncharacterized protein LOC105126913
TrEMBLA9PJK40.0A9PJK4_9ROSI; Uncharacterized protein
STRINGPOPTR_0002s05980.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF1312233
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38340.11e-10Nin-like family protein