PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | CCG016576.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 192aa MW: 21993.3 Da PI: 7.7023 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 80.1 | 1.5e-25 | 10 | 58 | 2 | 50 |
---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS SRF-TF 2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50 rien+ rqvtf+kRr+g+lKKA+ELSvLCdae+ v ifs +gklye + CCG016576.1 10 RIENHVHRQVTFCKRRAGLLKKAKELSVLCDAEIGVFIFSAHGKLYELA 58 8*********************************************965 PP | |||||||
2 | K-box | 46.1 | 2.2e-16 | 94 | 170 | 17 | 92 |
K-box 17 lqqelakLkkeienLqreqRhllGed.LesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenk 92 ++e++ Lk+eie Lq+ +R + G ++sl eL Le++Le+ + +iRs+K+e+l++ ++l +k +e+ e+++ CCG016576.1 94 TKEEINMLKQEIEVLQKGLRYMFGARaAAEMSLDELLVLEKHLENWIYQIRSTKEEILTAANQHLHNKVEENAEITN 170 579*********************862579****************************************9999876 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50066 | 29.464 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 7.46E-27 | 1 | 74 | IPR002100 | Transcription factor, MADS-box |
SMART | SM00432 | 1.7E-34 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 1.04E-38 | 2 | 78 | No hit | No description |
PRINTS | PR00404 | 1.7E-26 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 2.1E-22 | 10 | 56 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.7E-26 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.7E-26 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS51297 | 9.376 | 91 | 180 | IPR002487 | Transcription factor, K-box |
Pfam | PF01486 | 7.2E-15 | 94 | 167 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0010228 | Biological Process | vegetative to reproductive phase transition of meristem | ||||
GO:0048364 | Biological Process | root development | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 192 aa Download sequence Send to blast |
MARGKVQLRR IENHVHRQVT FCKRRAGLLK KAKELSVLCD AEIGVFIFSA HGKLYELATK 60 GTMQGLIEKY MKSSRGAQPE PAALETQPAP DLDTKEEINM LKQEIEVLQK GLRYMFGARA 120 AAEMSLDELL VLEKHLENWI YQIRSTKEEI LTAANQHLHN KVEENAEITN FVSVTTDFPH 180 PLTTQNEIRF QY |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5f28_A | 1e-15 | 1 | 96 | 1 | 92 | MEF2C |
5f28_B | 1e-15 | 1 | 96 | 1 | 92 | MEF2C |
5f28_C | 1e-15 | 1 | 96 | 1 | 92 | MEF2C |
5f28_D | 1e-15 | 1 | 96 | 1 | 92 | MEF2C |
6byy_A | 1e-15 | 1 | 96 | 1 | 92 | MEF2 CHIMERA |
6byy_B | 1e-15 | 1 | 96 | 1 | 92 | MEF2 CHIMERA |
6byy_C | 1e-15 | 1 | 96 | 1 | 92 | MEF2 CHIMERA |
6byy_D | 1e-15 | 1 | 96 | 1 | 92 | MEF2 CHIMERA |
6bz1_A | 1e-15 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
6bz1_B | 1e-15 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
6bz1_C | 1e-15 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
6bz1_D | 1e-15 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription activator that regulates root development by controlling cell proliferation in root meristem. May mediate responses to auxin in the root. May act as promoter of the flowering transition through up-regulation of SOC, FT and LFY. {ECO:0000269|PubMed:18203871}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By auxin in root phloem. {ECO:0000269|PubMed:18203871}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_011031550.1 | 1e-138 | PREDICTED: agamous-like MADS-box protein AGL12 | ||||
Swissprot | Q38841 | 4e-66 | AGL12_ARATH; Agamous-like MADS-box protein AGL12 | ||||
TrEMBL | A0A2K1WR83 | 1e-131 | A0A2K1WR83_POPTR; Uncharacterized protein | ||||
STRING | POPTR_0019s10540.1 | 1e-127 | (Populus trichocarpa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF7566 | 31 | 44 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G71692.1 | 2e-68 | AGAMOUS-like 12 |
Publications ? help Back to Top | |||
---|---|---|---|
|