PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | CCG002724.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
|
||||||||
Family | Dof | ||||||||
Protein Properties | Length: 160aa MW: 17804.1 Da PI: 9.358 | ||||||||
Description | Dof family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | zf-Dof | 124.2 | 4.2e-39 | 39 | 97 | 2 | 60 |
zf-Dof 2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkk 60 +ek+++cprC+s++tkfCy+nny+++qPr+fCk+C+ryWt+GGalrnvPvG+grrk k CCG002724.1 39 PEKIIQCPRCKSMETKFCYFNNYNVNQPRHFCKGCQRYWTAGGALRNVPVGAGRRKTKP 97 68999***************************************************986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
ProDom | PD007478 | 2.0E-24 | 38 | 88 | IPR003851 | Zinc finger, Dof-type |
Pfam | PF02701 | 3.5E-32 | 41 | 96 | IPR003851 | Zinc finger, Dof-type |
PROSITE profile | PS50884 | 28.09 | 43 | 97 | IPR003851 | Zinc finger, Dof-type |
PROSITE pattern | PS01361 | 0 | 45 | 81 | IPR003851 | Zinc finger, Dof-type |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 160 aa Download sequence Send to blast |
MASQEEGIKL FGATITLQDG QVIRKEDQNK ENPTIDKRPE KIIQCPRCKS METKFCYFNN 60 YNVNQPRHFC KGCQRYWTAG GALRNVPVGA GRRKTKPPGR GGPGGYSEEC LFDGSGGVHQ 120 FELDGVVLEE LHLATTHGGF RQVFPVKRRR SGGSGGQNCW |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence. Acts as a negative regulator in the phytochrome-mediated light responses. Controls phyB-mediated end-of-day response and the phyA-mediated anthocyanin accumulation. Not involved in direct flowering time regulation. {ECO:0000269|PubMed:19619493}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By red or far-red light. Circadian-regulation. The transcript level rises progressively from dawn and decreases during the night. {ECO:0000269|PubMed:19619493}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_011045933.1 | 1e-117 | PREDICTED: dof zinc finger protein DOF1.5 | ||||
Swissprot | P68350 | 4e-60 | DOF15_ARATH; Dof zinc finger protein DOF1.5 | ||||
TrEMBL | A0A3N7GJN5 | 1e-104 | A0A3N7GJN5_POPTR; Uncharacterized protein | ||||
STRING | POPTR_0011s07400.1 | 1e-104 | (Populus trichocarpa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF6483 | 32 | 51 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G29160.1 | 2e-50 | Dof family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|