PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | CCG002566.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 215aa MW: 24747.1 Da PI: 8.4684 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 44.5 | 3.7e-14 | 11 | 58 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g WT eEd +l d+vk +G+g W++ a+ g++R +k+c++rw +yl CCG002566.1 11 KGLWTVEEDRILMDYVKVHGKGKWNRAAEVTGLKRGGKSCRLRWMNYL 58 678***********************99999999************97 PP | |||||||
2 | Myb_DNA-binding | 61.9 | 1.3e-19 | 64 | 109 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg++++eEd+l+++++k+lG++ W++Ia +++ gRt++q+k++w+++l CCG002566.1 64 RGAFSEEEDDLIIRLHKLLGNR-WSLIAGRIP-GRTDNQVKNHWNTHL 109 89********************.*********.************996 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 14.824 | 6 | 58 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 4.23E-30 | 9 | 105 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 1.8E-10 | 10 | 60 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.7E-12 | 11 | 58 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 3.4E-21 | 12 | 65 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 1.37E-8 | 14 | 58 | No hit | No description |
PROSITE profile | PS51294 | 29.162 | 59 | 113 | IPR017930 | Myb domain |
SMART | SM00717 | 3.8E-18 | 63 | 111 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 4.0E-18 | 64 | 109 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 7.92E-13 | 66 | 109 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 5.7E-27 | 66 | 113 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0045165 | Biological Process | cell fate commitment | ||||
GO:0045893 | Biological Process | positive regulation of transcription, DNA-templated | ||||
GO:0048765 | Biological Process | root hair cell differentiation | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 215 aa Download sequence Send to blast |
MEGVGSREYR KGLWTVEEDR ILMDYVKVHG KGKWNRAAEV TGLKRGGKSC RLRWMNYLSP 60 SVKRGAFSEE EDDLIIRLHK LLGNRWSLIA GRIPGRTDNQ VKNHWNTHLS KKLGIKKRKC 120 KISDSSSKLS DKLEANFPNK LSSNDESIPC NNNTEIELQN VIEGSHEKAK EINSTHEPTI 180 RNDCYENFWL SYDDPYLCIP SLMELSDESL GFFMP |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 3e-28 | 11 | 113 | 7 | 108 | B-MYB |
1h8a_C | 5e-28 | 8 | 113 | 24 | 128 | MYB TRANSFORMING PROTEIN |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator, when associated with BHLH2/EGL3/MYC146 or BHLH12/MYC1. Involved in epidermal cell fate specification in roots and hypocotyl. Together with GL3 or BHLH2, promotes the formation of non-hair developing cells (atrichoblasts) et the N position in root epidermis. Regulates stomata spatial distribution in hypocotyls. Binds to the WER-binding sites (WBS) promoter regions and activates the transcription of target genes such as GL2 and of CPC. {ECO:0000269|PubMed:10589676, ECO:0000269|PubMed:11585796, ECO:0000269|PubMed:14627722, ECO:0000269|PubMed:15361138, ECO:0000269|PubMed:15795220, ECO:0000269|PubMed:16207757}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Transcriptional activation correlates with reduced histone acetylation on H3 and H4 mediated by HDA18 in N cells. Repressed by CPC in hair cells (H position). {ECO:0000269|PubMed:11910008, ECO:0000269|PubMed:16176989}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_011028575.1 | 1e-140 | PREDICTED: transcription factor WER-like isoform X3 | ||||
Swissprot | Q9SEI0 | 2e-69 | WER_ARATH; Transcription factor WER | ||||
TrEMBL | A0A3N7G3Y7 | 1e-124 | A0A3N7G3Y7_POPTR; Uncharacterized protein | ||||
STRING | POPTR_0015s08700.1 | 1e-117 | (Populus trichocarpa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF31 | 34 | 817 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G14750.1 | 5e-64 | myb domain protein 66 |