PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CCG001377.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family Nin-like
Protein Properties Length: 934aa    MW: 104596 Da    PI: 6.7323
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CCG001377.1genomeLZUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK87.79.6e-28616665352
       RWP-RK   3 keisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                  ++isle+l++yF++++kdAA++L vc+T+LKriCRq+GI RWP+Rkik++
  CCG001377.1 616 QTISLEVLRQYFAGSLKDAAQSLSVCPTTLKRICRQHGITRWPSRKIKKV 665
                  78**********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.427601685IPR003035RWP-RK domain
PfamPF020424.0E-25617665IPR003035RWP-RK domain
SuperFamilySSF542772.68E-18838925No hitNo description
Gene3DG3DSA:3.10.20.2401.2E-19841921No hitNo description
SMARTSM006661.5E-13841924IPR000270PB1 domain
PROSITE profilePS5174520.008841924IPR000270PB1 domain
PfamPF005644.1E-14842921IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 934 aa     Download sequence    Send to blast
MDEHSSSTPN STFGIFSGNP MNWDFMDEIL YQGWAENDGE FSFLQQGPAT SNVLYDHPSL  60
YIPFMGSNNL SIASNQQDYQ EETERHCHGN PPLDYPKSME LVQTEPQVED SVDTSTSLLH  120
TTGYRVEAAG LGFEWQMVPR VNPVTSFSVK ERAMQAIIYL KNCIQYKDSL IQIWLPVEKE  180
GKKVLATIDQ PYFVNPSCKS LASYRNVSTA YHFQVEGDAT FSVGFPGRVF LEKLPEWTPD  240
VSLFRSEEYP RKDHAIQHNI RGSLALPLFK QGSETCLGIV EIVTTSQKIT YRPELEDICK  300
ALKAVDLRSS EDFCSPGVKT CNGLNQVAVP EISEIVKSVC KTYGLPLALT WTLCSRQGKS  360
GRQQFAEKSG AFISTVDSAC FLADRDFSGF HMASFEQYIF LGQGIVGKAF TTQKQCFAND  420
VTCFSKKDYP LAHHAKIFGL HAAIAIPLRS IATGLVEFVL ELFLPIDCKD TEEQKKMWDL  480
LPIAIQQVCW SLQVVMDKGL DNGENQSFES SHSKQPSLDE SSWISRMVEA QKKSKSFCVT  540
WGYPKEPKEE FKMITHWDDS AVELDHKQVI SELGQLQQNS RPNSNTEGDG VSAFGRHLSF  600
GSRKTGKKRR TKTDIQTISL EVLRQYFAGS LKDAAQSLSV CPTTLKRICR QHGITRWPSR  660
KIKKVDHSLR KLQQVIDTVQ GAKGSIQIES FYSAFPELSS TKLSSPAPSS SFRTSDNSRH  720
FDSPPDDAIF SGTTSKSHSS PCSRSSCSST CCSARAQQHA ATVITGSSNE NGALPAETSN  780
GVLKRTSGSE LAEFYSLNNE GEPDFLLRPH IHKTRTINEQ IHQSLLETPP QFGQSRRGGD  840
VFRVKAIFGV EKVRLFLQPN WGLRDLQQEI GKCFKIDDFT GIGLKYMDDD GEWIRLNRDD  900
DLEECKETHK FCQSNTIKLS LYKYSTAFGS RGSC
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1606611KKRRTK
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011033170.10.0PREDICTED: protein NLP2-like
RefseqXP_011033171.10.0PREDICTED: protein NLP2-like
TrEMBLB9IHW60.0B9IHW6_POPTR; Uncharacterized protein
STRINGPOPTR_0016s04220.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF12373399
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G17150.10.0Nin-like family protein