PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | CCG000015.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 174aa MW: 18800 Da PI: 5.8261 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 185.4 | 4.4e-58 | 25 | 121 | 1 | 97 |
NF-YB 1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelegek 97 vreqdr+lPian+srimkk+lPan+ki+kdak+tvqecvsefisfvtseasdkcq+ekrktingddllwa+atlGfedy+eplkvyl++yreleg+ CCG000015.1 25 VREQDRYLPIANISRIMKKALPANGKIAKDAKDTVQECVSEFISFVTSEASDKCQKEKRKTINGDDLLWAMATLGFEDYIEPLKVYLARYRELEGDA 121 69********************************************************************************************996 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 1.9E-54 | 20 | 131 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 2.95E-40 | 28 | 131 | IPR009072 | Histone-fold |
Pfam | PF00808 | 2.1E-28 | 31 | 95 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 2.1E-21 | 59 | 77 | No hit | No description |
PROSITE pattern | PS00685 | 0 | 62 | 78 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
PRINTS | PR00615 | 2.1E-21 | 78 | 96 | No hit | No description |
PRINTS | PR00615 | 2.1E-21 | 97 | 115 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 174 aa Download sequence Send to blast |
MADNPTSPAA GSHESGGEQS PRSGVREQDR YLPIANISRI MKKALPANGK IAKDAKDTVQ 60 ECVSEFISFV TSEASDKCQK EKRKTINGDD LLWAMATLGF EDYIEPLKVY LARYRELEGD 120 AKGSARGGDG SSKRDAVGGL PGQNAQFAFQ GSMNYTSPQV QGQHMILPSM PGNE |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4awl_B | 7e-48 | 24 | 116 | 2 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
4csr_A | 7e-48 | 24 | 116 | 2 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_011036599.1 | 1e-128 | PREDICTED: nuclear transcription factor Y subunit B-1 isoform X1 | ||||
Refseq | XP_011037351.1 | 1e-128 | PREDICTED: nuclear transcription factor Y subunit B-1 isoform X2 | ||||
Refseq | XP_011038112.1 | 1e-128 | PREDICTED: nuclear transcription factor Y subunit B-1 isoform X2 | ||||
Refseq | XP_024461881.1 | 1e-128 | nuclear transcription factor Y subunit B-1 isoform X1 | ||||
Refseq | XP_024461882.1 | 1e-128 | nuclear transcription factor Y subunit B-1 isoform X1 | ||||
Refseq | XP_024461883.1 | 1e-128 | nuclear transcription factor Y subunit B-1 isoform X1 | ||||
Swissprot | Q8VYK4 | 4e-83 | NFYB8_ARATH; Nuclear transcription factor Y subunit B-8 | ||||
TrEMBL | A0A2K1ZBP5 | 1e-127 | A0A2K1ZBP5_POPTR; Uncharacterized protein | ||||
STRING | XP_002523912.1 | 1e-117 | (Ricinus communis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF2545 | 33 | 82 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G37060.3 | 2e-85 | nuclear factor Y, subunit B8 |
Publications ? help Back to Top | |||
---|---|---|---|
|