PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | PEQU_42224 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Vandeae; Aeridinae; Phalaenopsis
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 49aa MW: 5621.47 Da PI: 8.9026 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 42.8 | 1.2e-13 | 14 | 45 | 1 | 32 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmg 32 +g+WT+eEd++l+d+++++G gtW+t ++ g PEQU_42224 14 KGPWTPEEDQKLIDYIQKHGHGTWRTLPKNAG 45 79************************999876 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 2.1E-15 | 5 | 43 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 14.389 | 9 | 49 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 1.79E-10 | 9 | 43 | IPR009057 | Homeodomain-like |
Pfam | PF00249 | 9.7E-11 | 14 | 45 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 5.59E-7 | 16 | 45 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 49 aa Download sequence Send to blast |
MGRVPCCDKN GLKKGPWTPE EDQKLIDYIQ KHGHGTWRTL PKNAGIHYC |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor that may function in osmotic stress and wounding signaling pathways (Probable). Contributes to basal resistance against the herbivore Pieris rapae (white cabbage butterfly) feeding (PubMed:19517001). {ECO:0000269|PubMed:19517001, ECO:0000305|PubMed:12857823}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by light (PubMed:8980549). Induced by wounding, salt stress and abscisic acid (PubMed:12857823). Induced by the lepidopteran herbivore Pieris rapae (white cabbage butterfly) feeding (PubMed:19517001). {ECO:0000269|PubMed:12857823, ECO:0000269|PubMed:19517001, ECO:0000269|PubMed:8980549}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020698110.1 | 6e-30 | transcription factor MYB41-like | ||||
Swissprot | Q9LDR8 | 6e-26 | MY102_ARATH; Transcription factor MYB102 | ||||
TrEMBL | A0A2I0WRZ5 | 1e-28 | A0A2I0WRZ5_9ASPA; Transcription factor MYB39 | ||||
STRING | cassava4.1_010339m | 2e-27 | (Manihot esculenta) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G21440.1 | 3e-28 | MYB-like 102 |
Publications ? help Back to Top | |||
---|---|---|---|
|