PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PEQU_41555
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Vandeae; Aeridinae; Phalaenopsis
Family MYB
Protein Properties Length: 239aa    MW: 27026.1 Da    PI: 5.4081
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PEQU_41555genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.26.9e-171670148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT.......TTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmg.......kgRtlkqcksrwqkyl 48
                     rg+WT+eEd +l+ +++++G g+W++ ++  g       + R++k+c++rw +yl
       PEQU_41555 16 RGAWTPEEDMRLIAYITKYGHGNWRALPKQAGrhhkftgLLRCGKSCRLRWINYL 70
                     89***************************************************97 PP

2Myb_DNA-binding52.11.5e-1676121148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++++eE++ +++++++lG++ W++Ia+ ++ gRt++++k+ w+++l
       PEQU_41555  76 RGNFSAEEEDTIIKLHNLLGNK-WSKIASSLP-GRTDNEIKNVWNTHL 121
                      89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.9E-24773IPR009057Homeodomain-like
PROSITE profilePS5129413.5331170IPR017930Myb domain
SuperFamilySSF466898.98E-3013117IPR009057Homeodomain-like
SMARTSM007171.0E-121572IPR001005SANT/Myb domain
PfamPF002491.1E-141670IPR001005SANT/Myb domain
CDDcd001671.24E-91870No hitNo description
PROSITE profilePS5129423.38371125IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.4E-2674124IPR009057Homeodomain-like
SMARTSM007171.2E-1475123IPR001005SANT/Myb domain
PfamPF002492.0E-1576121IPR001005SANT/Myb domain
CDDcd001672.93E-1078121No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009809Biological Processlignin biosynthetic process
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 239 aa     Download sequence    Send to blast
MGRGRAPCCE KVGLNRGAWT PEEDMRLIAY ITKYGHGNWR ALPKQAGRHH KFTGLLRCGK  60
SCRLRWINYL RPDIKRGNFS AEEEDTIIKL HNLLGNKWSK IASSLPGRTD NEIKNVWNTH  120
LKKRFKSNEE FSSSPTPVIA LDTPSSSSSE ATSASIEHNT LDLPDYFDAW SLPDVDINDS  180
IDEILENDAA VAEERRRWLT YLEEELGLFE GGGGGDDEEM VEMDPVRSYF QNSHSSPSP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C3e-261412525128MYB TRANSFORMING PROTEIN
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that regulates positively genes involved in anthocyanin biosynthesis such as A1. {ECO:0000269|PubMed:7920701}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00144DAPTransfer from AT1G16490Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020595305.11e-145myb-related protein Zm1-like
SwissprotP200241e-70MYB1_MAIZE; Myb-related protein Zm1
TrEMBLA0A2I0WP981e-104A0A2I0WP98_9ASPA; Myb-related protein Zm1
STRINGGSMUA_Achr5P03520_0016e-76(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP21543798
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G16490.15e-67myb domain protein 58
Publications ? help Back to Top
  1. Franken P,Schrell S,Peterson PA,Saedler H,Wienand U
    Molecular analysis of protein domain function encoded by the myb-homologous maize genes C1, Zm 1 and Zm 38.
    Plant J., 1994. 6(1): p. 21-30
    [PMID:7920701]