PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | PEQU_40578 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Vandeae; Aeridinae; Phalaenopsis
|
||||||||
Family | LBD | ||||||||
Protein Properties | Length: 142aa MW: 15596.8 Da PI: 8.0588 | ||||||||
Description | LBD family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | DUF260 | 141.7 | 2.4e-44 | 16 | 115 | 1 | 100 |
DUF260 1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallke 99 +CaaCk+lrrkC ++C++apyfp e+p+kf nvhk+FGasnv+kll++l +++reda++sl+yeA+ar++dPvyG+vg i+ lqqq++ l++el+++++ PEQU_40578 16 PCAACKFLRRKCMQGCIFAPYFPPEEPQKFFNVHKIFGASNVTKLLNELLPHQREDAVNSLAYEADARMKDPVYGCVGAISVLQQQVQLLQKELDAANA 114 7*********************************************************************************************99886 PP DUF260 100 e 100 + PEQU_40578 115 N 115 5 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50891 | 27.257 | 15 | 116 | IPR004883 | Lateral organ boundaries, LOB |
Pfam | PF03195 | 1.3E-43 | 16 | 113 | IPR004883 | Lateral organ boundaries, LOB |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 142 aa Download sequence Send to blast |
AAMSSYSSSS ASSNSPCAAC KFLRRKCMQG CIFAPYFPPE EPQKFFNVHK IFGASNVTKL 60 LNELLPHQRE DAVNSLAYEA DARMKDPVYG CVGAISVLQQ QVQLLQKELD AANANLLKYA 120 CSYCHPSAHA GHQQVLLPYH SS |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5ly0_A | 1e-65 | 7 | 122 | 2 | 117 | LOB family transfactor Ramosa2.1 |
5ly0_B | 1e-65 | 7 | 122 | 2 | 117 | LOB family transfactor Ramosa2.1 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Not known; ectopic expression of LOB leads to alterations in the size and shape of leaves and floral organs and causes male and female sterility. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Positively regulated within the shoot apex by both ASYMMETRIC LEAVES 1 (AS1) and ASYMMETRIC LEAVES 2 (AS2/LBD6) and by KNAT1. {ECO:0000269|PubMed:11934861}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020572649.1 | 1e-100 | protein LATERAL ORGAN BOUNDARIES-like | ||||
Refseq | XP_020572651.1 | 1e-100 | protein LATERAL ORGAN BOUNDARIES-like | ||||
Refseq | XP_020572652.1 | 1e-100 | protein LATERAL ORGAN BOUNDARIES-like | ||||
Refseq | XP_020572653.1 | 1e-100 | protein LATERAL ORGAN BOUNDARIES-like | ||||
Refseq | XP_020572654.1 | 1e-100 | protein LATERAL ORGAN BOUNDARIES-like | ||||
Refseq | XP_020572655.1 | 1e-100 | protein LATERAL ORGAN BOUNDARIES-like | ||||
Refseq | XP_020594900.1 | 1e-100 | protein LATERAL ORGAN BOUNDARIES-like | ||||
Swissprot | Q9FML4 | 7e-67 | LOB_ARATH; Protein LATERAL ORGAN BOUNDARIES | ||||
TrEMBL | A0A200RB00 | 2e-70 | A0A200RB00_9MAGN; Uncharacterized protein | ||||
STRING | XP_008464527.1 | 4e-70 | (Cucumis melo) | ||||
STRING | XP_004173060.1 | 4e-70 | (Cucumis sativus) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP8813 | 35 | 45 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G63090.4 | 6e-56 | LBD family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|