PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | PEQU_37467 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Vandeae; Aeridinae; Phalaenopsis
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 183aa MW: 21797 Da PI: 9.2138 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 161.3 | 3.7e-50 | 24 | 149 | 2 | 128 |
NAM 2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelv 100 +pGfrFhPt+eel+ +yL++kvegk++++ e i+ +d+y+++Pw+Lp+ ++ +ekew+f+++rd+ky++g+r+nr+t+sgyWkatg d+ + +++ + + PEQU_37467 24 MPGFRFHPTEEELIEFYLRRKVEGKHFNV-ELITFLDLYRYDPWELPELAAIGEKEWFFYVPRDRKYRNGDRPNRVTTSGYWKATGADRMIRNESLRSI 121 79***************************.89***************8778899***************************************999*** PP NAM 101 glkktLvfykgrapkgektdWvmheyrl 128 glkktLvfy+g+apkg +t+W+m+eyrl PEQU_37467 122 GLKKTLVFYSGKAPKGIRTTWIMNEYRL 149 **************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 6.54E-53 | 23 | 158 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 51.105 | 23 | 167 | IPR003441 | NAC domain |
Pfam | PF02365 | 2.2E-25 | 25 | 149 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 183 aa Download sequence Send to blast |
MAIAAAMSND GEKDVDGHEH DLVMPGFRFH PTEEELIEFY LRRKVEGKHF NVELITFLDL 60 YRYDPWELPE LAAIGEKEWF FYVPRDRKYR NGDRPNRVTT SGYWKATGAD RMIRNESLRS 120 IGLKKTLVFY SGKAPKGIRT TWIMNEYRLP QSETDRFHMV IVLIVLDFRS PWDRRHNWKL 180 ITL |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ut4_A | 6e-54 | 8 | 149 | 2 | 142 | NO APICAL MERISTEM PROTEIN |
1ut4_B | 6e-54 | 8 | 149 | 2 | 142 | NO APICAL MERISTEM PROTEIN |
1ut7_A | 6e-54 | 8 | 149 | 2 | 142 | NO APICAL MERISTEM PROTEIN |
1ut7_B | 6e-54 | 8 | 149 | 2 | 142 | NO APICAL MERISTEM PROTEIN |
4dul_A | 6e-54 | 8 | 149 | 2 | 142 | NAC domain-containing protein 19 |
4dul_B | 6e-54 | 8 | 149 | 2 | 142 | NAC domain-containing protein 19 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that acts as a floral repressor. Controls flowering time by negatively regulating CONSTANS (CO) expression in a GIGANTEA (GI)-independent manner. Regulates the plant cold response by positive regulation of the cold response genes COR15A and KIN1. May coordinate cold response and flowering time. {ECO:0000269|PubMed:17653269}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Circadian regulation with a peak of expression at dawn under continuous light conditions (PubMed:17653269). Circadian regulation with a peak of expression around dusk and lowest expression around dawn under continuous light conditions (at protein level) (PubMed:17653269). {ECO:0000269|PubMed:17653269}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020598401.1 | 1e-115 | NAC domain-containing protein 35-like, partial | ||||
Swissprot | Q9ZVP8 | 1e-87 | NAC35_ARATH; NAC domain-containing protein 35 | ||||
TrEMBL | A0A2I0VV14 | 1e-105 | A0A2I0VV14_9ASPA; NAC domain-containing protein 94 | ||||
STRING | GSMUA_Achr3P21690_001 | 2e-97 | (Musa acuminata) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP2826 | 37 | 87 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G02450.2 | 5e-90 | NAC domain containing protein 35 |
Publications ? help Back to Top | |||
---|---|---|---|
|