PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | PEQU_27822 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Vandeae; Aeridinae; Phalaenopsis
|
||||||||
Family | WRKY | ||||||||
Protein Properties | Length: 82aa MW: 9822.13 Da PI: 9.0182 | ||||||||
Description | WRKY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | WRKY | 78.6 | 7.1e-25 | 1 | 58 | 2 | 59 |
--SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 dD+y+W+KYGqK +kg + rsY++C ++C +kkkve ++dp+ +ei YegeHnh+ PEQU_27822 1 DDEYEWKKYGQKYIKGIKKYRSYFKCKNKNCGAKKKVEWPTNDPNNIEILYEGEHNHR 58 7********************************************************6 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF118290 | 5.36E-22 | 1 | 58 | IPR003657 | WRKY domain |
PROSITE profile | PS50811 | 22.068 | 1 | 60 | IPR003657 | WRKY domain |
SMART | SM00774 | 2.8E-20 | 1 | 59 | IPR003657 | WRKY domain |
Gene3D | G3DSA:2.20.25.80 | 2.7E-23 | 1 | 58 | IPR003657 | WRKY domain |
Pfam | PF03106 | 3.6E-22 | 1 | 58 | IPR003657 | WRKY domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 82 aa Download sequence Send to blast |
DDEYEWKKYG QKYIKGIKKY RSYFKCKNKN CGAKKKVEWP TNDPNNIEIL YEGEHNHRVI 60 IALELEEANK YDLATQMFGS RT |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1wj2_A | 7e-16 | 1 | 57 | 18 | 74 | Probable WRKY transcription factor 4 |
2lex_A | 7e-16 | 1 | 57 | 18 | 74 | Probable WRKY transcription factor 4 |
Search in ModeBase |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020595991.1 | 1e-34 | probable WRKY transcription factor 26 isoform X1 | ||||
TrEMBL | A0A2I0VZV9 | 3e-29 | A0A2I0VZV9_9ASPA; Putative WRKY transcription factor 3 | ||||
STRING | OS03T0657400-00 | 2e-23 | (Oryza sativa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP10158 | 34 | 44 |