PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | PEQU_18879 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Vandeae; Aeridinae; Phalaenopsis
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 232aa MW: 26875.2 Da PI: 5.9281 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 56.9 | 4.8e-18 | 14 | 61 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT+eEd +lv +++ +G g+W++ +++ g+ R++k+c++rw +yl PEQU_18879 14 KGPWTPEEDSILVSYIQTHGHGNWRALPKKAGLLRCGKSCRLRWTNYL 61 79******************************99************97 PP | |||||||
2 | Myb_DNA-binding | 52.2 | 1.4e-16 | 67 | 112 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg +++eE+e ++ +++lG++ W++Ia++++ gRt++++k++w+++l PEQU_18879 67 RGDFSKEEEETIIYMHAMLGNR-WSAIAAKLP-GRTDNEIKNFWHTHL 112 899*******************.*********.************986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 15.86 | 9 | 61 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 2.77E-30 | 10 | 108 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 1.5E-14 | 13 | 63 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 2.2E-16 | 14 | 61 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.1E-24 | 15 | 68 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 1.10E-10 | 16 | 61 | No hit | No description |
PROSITE profile | PS51294 | 24.829 | 62 | 116 | IPR017930 | Myb domain |
SMART | SM00717 | 2.2E-16 | 66 | 114 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 9.1E-15 | 67 | 112 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 5.6E-26 | 69 | 116 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 5.39E-11 | 70 | 112 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 232 aa Download sequence Send to blast |
MVRAPCCEAM GLKKGPWTPE EDSILVSYIQ THGHGNWRAL PKKAGLLRCG KSCRLRWTNY 60 LRPDVKRGDF SKEEEETIIY MHAMLGNRWS AIAAKLPGRT DNEIKNFWHT HLKKRLNPNQ 120 DIKKSNPREK VNPKEHRENT FEEQNSPLLI QNESPFFEIK TENNTADMKH SFINDSFEEY 180 FPEFDEILWS EEFAVGGEEE DGSMGQSFGQ PSLRNEDAIT FWLKLLAESG NL |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 5e-26 | 12 | 117 | 5 | 109 | B-MYB |
1h8a_C | 8e-26 | 12 | 116 | 25 | 128 | MYB TRANSFORMING PROTEIN |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional activator involved in cold stress response (PubMed:14675437, PubMed:20807373, PubMed:22246661). Regulates positively the expression of genes involved in reactive oxygen species (ROS) scavenging such as peroxidase and superoxide dismutase during cold stress. Transactivates a complex gene network that have major effects on stress tolerance and panicle development (PubMed:20807373). {ECO:0000269|PubMed:14675437, ECO:0000269|PubMed:20807373, ECO:0000269|PubMed:22246661}. | |||||
UniProt | Transcription factor involved in cold-regulation of CBF genes and in the development of freezing tolerance. May be part of a complex network of transcription factors controlling the expression of CBF genes and other genes in response to cold stress. Binds to the MYB recognition sequences in the promoters of CBF1, CBF2 and CBF3 genes (PubMed:17015446). Involved in drought and salt tolerance. May enhance expression levels of genes involved in abscisic acid (ABA) biosynthesis and signaling, as well as those encoding stress-protective proteins (PubMed:19161942). {ECO:0000269|PubMed:17015446, ECO:0000269|PubMed:19161942}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By cold stress. {ECO:0000269|PubMed:14675437, ECO:0000269|PubMed:20807373, ECO:0000269|Ref.2}. | |||||
UniProt | INDUCTION: Induced by abscisic acid (ABA) and drought stress (PubMed:19161942). Induced by salt stress (PubMed:19161942). {ECO:0000269|PubMed:19161942}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020579221.1 | 1e-174 | myb-related protein Myb4-like | ||||
Swissprot | Q7XBH4 | 6e-73 | MYB4_ORYSJ; Transcription factor MYB4 | ||||
Swissprot | Q9LTC4 | 2e-72 | MYB15_ARATH; Transcription factor MYB15 | ||||
TrEMBL | A0A455LAA4 | 1e-132 | A0A455LAA4_9ASPA; Myb-related protein Myb4-like protein | ||||
STRING | GSMUA_Achr1P09180_001 | 5e-84 | (Musa acuminata) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP79 | 38 | 563 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G23250.1 | 7e-75 | myb domain protein 15 |