PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PEQU_18823
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Vandeae; Aeridinae; Phalaenopsis
Family NAC
Protein Properties Length: 313aa    MW: 36523 Da    PI: 6.2726
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PEQU_18823genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM179.86.8e-5671361129
         NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvka...eekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskk 96 
                 +ppGfrFhPtdeelv++yL+kkv+++++++ +vik+vd+yk+ePwdL++k++    e++ewyfFs++dkky+tg+r+nrat++g+Wkatg+dk+++s k
  PEQU_18823   7 VPPGFRFHPTDEELVDYYLRKKVASRRIDV-DVIKDVDLYKIEPWDLQEKCDIgveEQNEWYFFSHKDKKYPTGTRTNRATTAGFWKATGRDKPIYS-K 103
                 69****************************.9***************963333233566**************************************.8 PP

         NAM  97 gelvglkktLvfykgrapkgektdWvmheyrle 129
                 ++lvg++ktLvfykgrap+g+k dW+mheyrle
  PEQU_18823 104 DNLVGMRKTLVFYKGRAPNGQKLDWIMHEYRLE 136
                 99*****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.05E-615156IPR003441NAC domain
PROSITE profilePS5100560.0717156IPR003441NAC domain
PfamPF023652.5E-288135IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048759Biological Processxylem vessel member cell differentiation
GO:1901348Biological Processpositive regulation of secondary cell wall biogenesis
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 313 aa     Download sequence    Send to blast
MTSFSLVPPG FRFHPTDEEL VDYYLRKKVA SRRIDVDVIK DVDLYKIEPW DLQEKCDIGV  60
EEQNEWYFFS HKDKKYPTGT RTNRATTAGF WKATGRDKPI YSKDNLVGMR KTLVFYKGRA  120
PNGQKLDWIM HEYRLETDEN GPPQEEGWVV CRVFRKRIAS TQTLINHDSP SCHWYDESVP  180
FIPQFDSPKK LTYPNTETYH HPSLCYNCKP ELEVINHNHL LQNHSFLDLP HLESPKFPHF  240
INHETLQNNH QLQIVTDWRI FDKFVASQLS QDDVSKESDV CNLEKANDVA GKEIVAAECA  300
STSTSGEQID LWK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A3e-51715715169Stress-induced transcription factor NAC1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that binds to the secondary wall NAC binding element (SNBE), 5'-(T/A)NN(C/T)(T/C/G)TNNNNNNNA(A/C)GN(A/C/T)(A/T)-3', in the promoter of target genes (By similarity). Involved in xylem formation by promoting the expression of secondary wall-associated transcription factors and of genes involved in secondary wall biosynthesis and programmed cell death, genes driven by the secondary wall NAC binding element (SNBE). Triggers thickening of secondary walls (PubMed:16103214, PubMed:25148240). {ECO:0000250|UniProtKB:Q9LVA1, ECO:0000269|PubMed:16103214, ECO:0000269|PubMed:25148240}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00136DAPTransfer from AT1G12260Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020583137.10.0NAC domain-containing protein 7-like
SwissprotQ9FWX21e-120NAC7_ARATH; NAC domain-containing protein 7
TrEMBLA0A2I0VU590.0A0A2I0VU59_9ASPA; NAC domain-containing protein 7
STRINGXP_008812366.11e-153(Phoenix dactylifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23703892
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G12260.11e-105NAC 007
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Heyndrickx KS,Vandepoele K
    Systematic identification of functional plant modules through the integration of complementary data sources.
    Plant Physiol., 2012. 159(3): p. 884-901
    [PMID:22589469]