PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | PEQU_14880 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Vandeae; Aeridinae; Phalaenopsis
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 113aa MW: 13050.8 Da PI: 9.7599 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 58.2 | 1.8e-18 | 11 | 58 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT+eEde+lv+++++ G g+Wk++a+ g+ R +k+c++rw +yl PEQU_14880 11 KGKWTEEEDEILVKYIAENGEGSWKSVAKNTGLLRGGKSCRLRWINYL 58 79******************************99************97 PP | |||||||
2 | Myb_DNA-binding | 55.6 | 1.2e-17 | 64 | 109 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg++++eE+e++++ + +G++ W++Ia+ ++ gRt++++k++w+++l PEQU_14880 64 RGNFSKEEEEIIIKFQASYGNR-WSLIASNLP-GRTDNEIKNYWNSHL 109 89********************.*********.************986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 9.0E-23 | 2 | 61 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 24.66 | 6 | 62 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 1.76E-29 | 8 | 105 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 8.2E-14 | 10 | 60 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 4.0E-17 | 11 | 58 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 2.11E-10 | 13 | 58 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 1.1E-25 | 62 | 113 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 1.2E-15 | 63 | 111 | IPR001005 | SANT/Myb domain |
PROSITE profile | PS51294 | 21.103 | 63 | 113 | IPR017930 | Myb domain |
Pfam | PF00249 | 6.5E-16 | 64 | 109 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 1.25E-11 | 66 | 109 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 113 aa Download sequence Send to blast |
TPCCEKNGLR KGKWTEEEDE ILVKYIAENG EGSWKSVAKN TGLLRGGKSC RLRWINYLKA 60 GVKRGNFSKE EEEIIIKFQA SYGNRWSLIA SNLPGRTDNE IKNYWNSHLC RRL |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1h8a_C | 2e-25 | 9 | 113 | 25 | 128 | MYB TRANSFORMING PROTEIN |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor postulated to regulate the biosynthetic pathway of a flavonoid-derived pigment in certain floral tissues. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020584902.1 | 8e-77 | myb-related protein P-like | ||||
Swissprot | P27898 | 5e-59 | MYBP_MAIZE; Myb-related protein P | ||||
TrEMBL | A0A097A5N2 | 1e-57 | A0A097A5N2_MAIZE; Myb-like transcription factor | ||||
TrEMBL | Q944N2 | 1e-57 | Q944N2_MAIZE; Myb-like transcription factor P1 | ||||
STRING | GRMZM2G051256_P01 | 5e-58 | (Zea mays) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP116 | 37 | 448 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G49330.1 | 2e-50 | myb domain protein 111 |