PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | PEQU_14562 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Vandeae; Aeridinae; Phalaenopsis
|
||||||||
Family | NF-YC | ||||||||
Protein Properties | Length: 145aa MW: 15978.9 Da PI: 4.6683 | ||||||||
Description | NF-YC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YC | 90 | 2.4e-28 | 1 | 71 | 30 | 100 |
NF-YC 30 lkadedvkmisaeaPvllskacelfileltlrswlhaeenkrrtlkksdiaaavtrtdifdflvdivprde 100 +k+dedvkmi+ae+P l+skacelfilelt sw + + kr+tl++ di+ +++ + fdflvdivp+++ PEQU_14562 1 MKSDEDVKMIAAEVPPLFSKACELFILELTHGSWCQVDREKRKTLQRGDISLEIAKHQAFDFLVDIVPEKK 71 9*******************************************************************986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF47113 | 2.97E-20 | 1 | 69 | IPR009072 | Histone-fold |
Gene3D | G3DSA:1.10.20.10 | 1.3E-23 | 1 | 69 | IPR009072 | Histone-fold |
Pfam | PF00808 | 2.3E-11 | 1 | 52 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 145 aa Download sequence Send to blast |
MKSDEDVKMI AAEVPPLFSK ACELFILELT HGSWCQVDRE KRKTLQRGDI SLEIAKHQAF 60 DFLVDIVPEK KVAESGAAAS TSMTISGDEQ LNQSISCFHD PSMLDSLMMD FRNSETVPHC 120 SISTQQHQHS NASENGESAA PNLSP |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5g49_B | 2e-23 | 1 | 69 | 27 | 95 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT C-3 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. {ECO:0000250}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020571601.1 | 1e-103 | nuclear transcription factor Y subunit C-2-like isoform X1 | ||||
Refseq | XP_020571603.1 | 1e-103 | nuclear transcription factor Y subunit C-6-like isoform X3 | ||||
Swissprot | Q9SMP0 | 2e-25 | NFYC1_ARATH; Nuclear transcription factor Y subunit C-1 | ||||
TrEMBL | A0A2H9ZQS6 | 7e-41 | A0A2H9ZQS6_9ASPA; Nuclear transcription factor Y subunit C-2 | ||||
STRING | GSMUA_Achr9P11550_001 | 9e-26 | (Musa acuminata) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP7345 | 35 | 51 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G48590.1 | 9e-28 | nuclear factor Y, subunit C1 |
Publications ? help Back to Top | |||
---|---|---|---|
|