PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | PEQU_11675 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Vandeae; Aeridinae; Phalaenopsis
|
||||||||
Family | NF-YC | ||||||||
Protein Properties | Length: 144aa MW: 15759.2 Da PI: 11.0962 | ||||||||
Description | NF-YC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YC | 24.1 | 7.7e-08 | 36 | 116 | 17 | 97 |
NF-YC 17 knhelPlarikkilkadedvkmisaeaPvllskacelfileltlrswlhaeenkrrtlkksdiaaavtrtdifdflvdivp 97 ++ ++P+ ri + lka + +i a aPv l+ e++ e+ + + a++nk+ + i+ av + + l+d+v PEQU_11675 36 ADLRFPVGRIARFLKAGKYAGRIGAGAPVYLAAVLEYLAAEILELAGNAAKDNKKVRITPRHIQLAVRNDTELSKLMDNVT 116 36789*************************************999*************************99999999885 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF00125 | 4.7E-18 | 16 | 103 | IPR007125 | Histone H2A/H2B/H3 |
SMART | SM00414 | 5.8E-66 | 17 | 137 | IPR002119 | Histone H2A |
Gene3D | G3DSA:1.10.20.10 | 2.4E-52 | 22 | 135 | IPR009072 | Histone-fold |
CDD | cd00074 | 1.97E-59 | 26 | 132 | No hit | No description |
PRINTS | PR00620 | 4.6E-43 | 28 | 50 | IPR002119 | Histone H2A |
SuperFamily | SSF47113 | 4.79E-41 | 29 | 132 | IPR009072 | Histone-fold |
PRINTS | PR00620 | 4.6E-43 | 57 | 72 | IPR002119 | Histone H2A |
PRINTS | PR00620 | 4.6E-43 | 72 | 85 | IPR002119 | Histone H2A |
PRINTS | PR00620 | 4.6E-43 | 86 | 100 | IPR002119 | Histone H2A |
Pfam | PF16211 | 4.5E-7 | 107 | 138 | IPR032454 | Histone H2A, C-terminal domain |
PRINTS | PR00620 | 4.6E-43 | 114 | 132 | IPR002119 | Histone H2A |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0000786 | Cellular Component | nucleosome | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 144 aa Download sequence Send to blast |
MAGRGRGRGR GRGRGRKEKE TRSSEKKVKR SRSSKADLRF PVGRIARFLK AGKYAGRIGA 60 GAPVYLAAVL EYLAAEILEL AGNAAKDNKK VRITPRHIQL AVRNDTELSK LMDNVTIPSS 120 GVTPAIHCFL VPLSTEKEAF DDEI |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
3c1b_C | 2e-49 | 13 | 136 | 2 | 121 | Histone H2A type 1 |
3c1b_G | 2e-49 | 13 | 136 | 2 | 121 | Histone H2A type 1 |
3c1c_C | 2e-49 | 13 | 136 | 2 | 121 | Histone H2A type 1 |
3c1c_G | 2e-49 | 13 | 136 | 2 | 121 | Histone H2A type 1 |
6ftx_C | 2e-49 | 13 | 136 | 3 | 122 | Histone H2A type 1 |
6ftx_G | 2e-49 | 13 | 136 | 3 | 122 | Histone H2A type 1 |
6g0l_G | 2e-49 | 13 | 136 | 3 | 122 | Histone H2A type 1 |
6ne3_C | 2e-49 | 13 | 136 | 3 | 122 | Histone H2A type 1 |
6ne3_G | 2e-49 | 13 | 136 | 3 | 122 | Histone H2A type 1 |
Search in ModeBase |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 5 | 14 | RGRGRGRGRG |
2 | 5 | 15 | RGRGRGRGRGR |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020591255.1 | 1e-100 | histone H2A-beta, sperm-like | ||||
Swissprot | O81826 | 2e-55 | H2A3_ARATH; Probable histone H2A.3 | ||||
TrEMBL | A0A2G5CFC3 | 5e-55 | A0A2G5CFC3_AQUCA; Histone H2A | ||||
TrEMBL | A0A2P2Q624 | 6e-55 | A0A2P2Q624_RHIMU; Histone H2A | ||||
STRING | Aquca_058_00211.1 | 9e-56 | (Aquilegia coerulea) |
Publications ? help Back to Top | |||
---|---|---|---|
|