PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | PEQU_10361 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Vandeae; Aeridinae; Phalaenopsis
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 204aa MW: 23906.4 Da PI: 7.921 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 53.6 | 5e-17 | 33 | 77 | 1 | 47 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 rg+ + eE+el+++++k+lG++ W++Ia +++ gRt++++k++w++ PEQU_10361 33 RGNISVEEEELIIRLHKLLGNR-WSLIAGRLP-GRTDNEIKNYWNTT 77 78999*****************.*********.************87 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50090 | 4.147 | 8 | 27 | IPR017877 | Myb-like domain |
SuperFamily | SSF46689 | 2.82E-21 | 13 | 88 | IPR009057 | Homeodomain-like |
Gene3D | G3DSA:1.10.10.60 | 1.7E-10 | 13 | 39 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 26.649 | 28 | 82 | IPR017930 | Myb domain |
SMART | SM00717 | 1.9E-16 | 32 | 80 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 5.7E-15 | 33 | 77 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 1.10E-11 | 37 | 78 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 2.1E-21 | 40 | 78 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 204 aa Download sequence Send to blast |
MRVYVYVIDE GLNRRGKSCR LRWLNYLRPN IKRGNISVEE EELIIRLHKL LGNRWSLIAG 60 RLPGRTDNEI KNYWNTTLSK KIQTKKFTIN MPNIKAWKPK SNPLETKITS FISYSIQTME 120 LKCTKASYPL HVLPSTSEVI QTQQMSQQNF REELMEEKQD KVLDCDSFSF DDEMWIAGLE 180 FGGEINVVDD YDNDLVCSLF DKNL |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 2e-21 | 13 | 84 | 39 | 110 | B-MYB |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator, when associated with BHLH2/EGL3/MYC146 or BHLH12/MYC1. Involved in epidermal cell fate specification in roots and hypocotyl. Together with GL3 or BHLH2, promotes the formation of non-hair developing cells (atrichoblasts) et the N position in root epidermis. Regulates stomata spatial distribution in hypocotyls. Binds to the WER-binding sites (WBS) promoter regions and activates the transcription of target genes such as GL2 and of CPC. {ECO:0000269|PubMed:10589676, ECO:0000269|PubMed:11585796, ECO:0000269|PubMed:14627722, ECO:0000269|PubMed:15361138, ECO:0000269|PubMed:15795220, ECO:0000269|PubMed:16207757}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Transcriptional activation correlates with reduced histone acetylation on H3 and H4 mediated by HDA18 in N cells. Repressed by CPC in hair cells (H position). {ECO:0000269|PubMed:11910008, ECO:0000269|PubMed:16176989}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | KF769476 | 0.0 | KF769476.1 Phalaenopsis equestris MYB transcription factor 11 (MYB11) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020573646.1 | 1e-143 | transcription factor MYB114-like | ||||
Refseq | XP_020573647.1 | 1e-143 | transcription factor MYB114-like | ||||
Refseq | XP_020573648.1 | 1e-143 | transcription factor MYB114-like | ||||
Swissprot | Q9SEI0 | 1e-37 | WER_ARATH; Transcription factor WER | ||||
TrEMBL | A0A096ZX39 | 1e-133 | A0A096ZX39_PHAEQ; MYB transcription factor 11 | ||||
STRING | ERN11222 | 1e-44 | (Amborella trichopoda) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP116 | 37 | 448 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G14750.1 | 5e-40 | myb domain protein 66 |