PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | PEQU_08374 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Vandeae; Aeridinae; Phalaenopsis
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 156aa MW: 18288.9 Da PI: 9.8616 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 163.9 | 5.7e-51 | 9 | 136 | 1 | 128 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkg 97 lppGf FhPtd el+++yL++k +g k+++ +vi+e+diyk ePwdLp+ ++ + +++w+fF+++dkky++g r+nrat++gyWk+tgkd+++ s ++ PEQU_08374 9 LPPGFGFHPTDVELISHYLRRKNRGLKIDF-DVIPELDIYKREPWDLPAccQIPTMDSKWHFFTSHDKKYPNGLRSNRATEAGYWKSTGKDRNIRS-HN 105 79****************************.9****************6346666889**************************************.99 PP NAM 98 elvglkktLvfykgrapkgektdWvmheyrl 128 +++g+kktLvf++gr p+g++tdW+mhey + PEQU_08374 106 QVIGTKKTLVFHEGRPPRGKRTDWIMHEYYM 136 9****************************76 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 6.67E-54 | 4 | 141 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 49.952 | 9 | 153 | IPR003441 | NAC domain |
Pfam | PF02365 | 2.4E-25 | 10 | 135 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 156 aa Download sequence Send to blast |
MEALKAISLP PGFGFHPTDV ELISHYLRRK NRGLKIDFDV IPELDIYKRE PWDLPACCQI 60 PTMDSKWHFF TSHDKKYPNG LRSNRATEAG YWKSTGKDRN IRSHNQVIGT KKTLVFHEGR 120 PPRGKRTDWI MHEYYMDEKE SKTSSQIKVL YFGGFL |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
3ulx_A | 1e-44 | 2 | 136 | 8 | 140 | Stress-induced transcription factor NAC1 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor involved in stress response. {ECO:0000250|UniProtKB:Q7F2L3}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by salt and cold stresses. {ECO:0000269|PubMed:18813954}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020572642.1 | 1e-108 | NAC domain-containing protein 74-like | ||||
Swissprot | Q7GCL7 | 6e-74 | NAC74_ORYSJ; NAC domain-containing protein 74 | ||||
TrEMBL | A0A2I0VXF7 | 3e-91 | A0A2I0VXF7_9ASPA; NAC domain-containing protein 74 | ||||
STRING | XP_008784959.1 | 2e-81 | (Phoenix dactylifera) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP7560 | 38 | 47 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G17730.1 | 2e-60 | NAC domain containing protein 57 |
Publications ? help Back to Top | |||
---|---|---|---|
|