PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | PEQU_08336 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Vandeae; Aeridinae; Phalaenopsis
|
||||||||
Family | WRKY | ||||||||
Protein Properties | Length: 76aa MW: 9179.43 Da PI: 9.9859 | ||||||||
Description | WRKY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | WRKY | 107.2 | 8.2e-34 | 16 | 74 | 1 | 59 |
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 ldDgy+WrKYGqK+vk++++prsYYrCt+ +C+vkk+ver aedp++v++tYeg+H h+ PEQU_08336 16 LDDGYKWRKYGQKVVKNTQHPRSYYRCTQDNCRVKKRVERLAEDPRMVITTYEGRHAHS 74 59********************************************************7 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:2.20.25.80 | 4.3E-35 | 1 | 74 | IPR003657 | WRKY domain |
SuperFamily | SSF118290 | 3.4E-30 | 8 | 74 | IPR003657 | WRKY domain |
PROSITE profile | PS50811 | 29.574 | 11 | 76 | IPR003657 | WRKY domain |
SMART | SM00774 | 4.0E-37 | 16 | 75 | IPR003657 | WRKY domain |
Pfam | PF03106 | 1.3E-26 | 17 | 73 | IPR003657 | WRKY domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0045893 | Biological Process | positive regulation of transcription, DNA-templated | ||||
GO:1901141 | Biological Process | regulation of lignin biosynthetic process | ||||
GO:1904369 | Biological Process | positive regulation of sclerenchyma cell differentiation | ||||
GO:0001046 | Molecular Function | core promoter sequence-specific DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 76 aa Download sequence Send to blast |
REPRFCFKTM SEVDVLDDGY KWRKYGQKVV KNTQHPRSYY RCTQDNCRVK KRVERLAEDP 60 RMVITTYEGR HAHSPS |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1wj2_A | 8e-29 | 7 | 73 | 8 | 74 | Probable WRKY transcription factor 4 |
2lex_A | 8e-29 | 7 | 73 | 8 | 74 | Probable WRKY transcription factor 4 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_008793465.1 | 8e-52 | probable WRKY transcription factor 13 | ||||
Refseq | XP_010915067.1 | 8e-52 | probable WRKY transcription factor 13 | ||||
Refseq | XP_020572540.1 | 8e-52 | probable WRKY transcription factor 13 | ||||
Refseq | XP_020678932.1 | 9e-52 | probable WRKY transcription factor 13 | ||||
Swissprot | Q9SVB7 | 2e-48 | WRK13_ARATH; Probable WRKY transcription factor 13 | ||||
TrEMBL | A0A218XBF0 | 9e-51 | A0A218XBF0_PUNGR; Uncharacterized protein | ||||
STRING | XP_008793465.1 | 3e-51 | (Phoenix dactylifera) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP1138 | 38 | 130 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G39410.1 | 7e-51 | WRKY DNA-binding protein 13 |