PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PEQU_07144
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Vandeae; Aeridinae; Phalaenopsis
Family NAC
Protein Properties Length: 398aa    MW: 45070 Da    PI: 7.1147
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PEQU_07144genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM168.91.6e-52141411128
         NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk.kge 98 
                 + pGfrFhPtdeelv +yL++k+++++l++ e i+++diyk++PwdLpk+++++ekewyf+++rd+ky+++ r+nr+t +g+Wkatg+d++++s+ +++
  PEQU_07144  14 MLPGFRFHPTDEELVGFYLRRKIQQRPLSI-ELIRQLDIYKYDPWDLPKMATTGEKEWYFYCPRDRKYRNSARPNRVTGAGFWKATGTDRPIYSSeGTK 111
                 579***************************.89***************9888999***************************************95666 PP

         NAM  99 lvglkktLvfykgrapkgektdWvmheyrl 128
                  +glkk+Lvfykgra kg ktdW+mhe+rl
  PEQU_07144 112 CIGLKKSLVFYKGRAAKGMKTDWMMHEFRL 141
                 7***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.97E-5813173IPR003441NAC domain
PROSITE profilePS5100556.79414173IPR003441NAC domain
PfamPF023651.2E-2516141IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009733Biological Processresponse to auxin
GO:0045770Biological Processpositive regulation of asymmetric cell division
GO:0048103Biological Processsomatic stem cell division
GO:0048829Biological Processroot cap development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 398 aa     Download sequence    Send to blast
MEEKSDMDKG DEIMLPGFRF HPTDEELVGF YLRRKIQQRP LSIELIRQLD IYKYDPWDLP  60
KMATTGEKEW YFYCPRDRKY RNSARPNRVT GAGFWKATGT DRPIYSSEGT KCIGLKKSLV  120
FYKGRAAKGM KTDWMMHEFR LPSLTDPSIS KRPVDKNFIP ANESWAICRI FKKTNTSTQR  180
ALSHSWVSSL PESTDLDKFS IPRAMNLTHF ASENTSCSTE IGSAIQFGCN STGLEHHGSA  240
VTYPSLDFAN FKSINLSSCK SSEMPTSFMF SPPETSMPIK PSVDVTSMLL NLSPNILQDM  300
EKSSPSIDFE QPHQTNGFTV TFPLEANGSL VTDEEEMISK KSLSCITGGN NQWGNLRTMN  360
FPFNLTNSSD DWKLNLLWDS ALCPSEMSTG YSTNKCYT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-531617919171NO APICAL MERISTEM PROTEIN
1ut4_B2e-531617919171NO APICAL MERISTEM PROTEIN
1ut7_A2e-531617919171NO APICAL MERISTEM PROTEIN
1ut7_B2e-531617919171NO APICAL MERISTEM PROTEIN
3swm_A2e-531617922174NAC domain-containing protein 19
3swm_B2e-531617922174NAC domain-containing protein 19
3swm_C2e-531617922174NAC domain-containing protein 19
3swm_D2e-531617922174NAC domain-containing protein 19
3swp_A2e-531617922174NAC domain-containing protein 19
3swp_B2e-531617922174NAC domain-containing protein 19
3swp_C2e-531617922174NAC domain-containing protein 19
3swp_D2e-531617922174NAC domain-containing protein 19
4dul_A2e-531617919171NAC domain-containing protein 19
4dul_B2e-531617919171NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtPromotes periclinal root capforming cell divisions. Activates expression of its negative regulator SMB in a feedback loop for controlled switches in cell division plane. {ECO:0000269|PubMed:19081078}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Repressed by SMB in oriented-divised root cap stem cells. {ECO:0000269|PubMed:19081078}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020575646.10.0protein FEZ-like
SwissprotQ9ZVH01e-107FEZ_ARATH; Protein FEZ
TrEMBLA0A2I0XBM00.0A0A2I0XBM0_9ASPA; Protein FEZ
STRINGXP_008784123.10.0(Phoenix dactylifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP33663882
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G26870.11e-109NAC family protein
Publications ? help Back to Top
  1. Bennett T,van den Toorn A,Willemsen V,Scheres B
    Precise control of plant stem cell activity through parallel regulatory inputs.
    Development, 2014. 141(21): p. 4055-64
    [PMID:25256342]