PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | PEQU_07007 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Vandeae; Aeridinae; Phalaenopsis
|
||||||||
Family | Dof | ||||||||
Protein Properties | Length: 147aa MW: 16011 Da PI: 9.1124 | ||||||||
Description | Dof family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | zf-Dof | 119.5 | 1.2e-37 | 44 | 97 | 6 | 59 |
zf-Dof 6 lkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknk 59 l+cprC+s++tkfCy+nny+++qPr+fCkaC+ryWt+GGalrnvPvG+grr+++ PEQU_07007 44 LACPRCKSKETKFCYFNNYNVNQPRHFCKACHRYWTAGGALRNVPVGAGRRRSR 97 78*************************************************987 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50884 | 28.202 | 44 | 98 | IPR003851 | Zinc finger, Dof-type |
ProDom | PD007478 | 4.0E-22 | 44 | 91 | IPR003851 | Zinc finger, Dof-type |
Pfam | PF02701 | 2.9E-31 | 44 | 97 | IPR003851 | Zinc finger, Dof-type |
PROSITE pattern | PS01361 | 0 | 46 | 82 | IPR003851 | Zinc finger, Dof-type |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0045892 | Biological Process | negative regulation of transcription, DNA-templated | ||||
GO:1902455 | Biological Process | negative regulation of stem cell population maintenance | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 147 aa Download sequence Send to blast |
MAEIGEESAA FKLFGTVIVA DENRLNKNSP PEPPAQSSPA AGDLACPRCK SKETKFCYFN 60 NYNVNQPRHF CKACHRYWTA GGALRNVPVG AGRRRSRLYG RSGGGTAVED DGVDCGAEVE 120 RWLLRREQMP AAAVGRKLSN ATGGRYC |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence (By similarity). Transcriptional repressor of 'CONSTANS' expression (By similarity). Regulates a photoperiodic flowering response. {ECO:0000250, ECO:0000269|PubMed:19619493}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Circadian-regulation. The transcript level rises progressively from dawn and decreases during the night. {ECO:0000269|PubMed:19619493}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020584695.1 | 1e-106 | cyclic dof factor 4-like | ||||
Swissprot | O22967 | 4e-38 | CDF4_ARATH; Cyclic dof factor 4 | ||||
TrEMBL | A0A2I0WQW3 | 8e-68 | A0A2I0WQW3_9ASPA; Cyclic dof factor 4 | ||||
STRING | GSMUA_Achr9P06430_001 | 1e-37 | (Musa acuminata) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP6495 | 28 | 51 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G34140.1 | 2e-31 | Dof family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|