PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | PEQU_06390 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Vandeae; Aeridinae; Phalaenopsis
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 166aa MW: 19504.8 Da PI: 10.738 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 42.6 | 1.4e-13 | 14 | 61 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg+W+ eEd++lv+ + G +W+ +++ g+ R++k+c++rw +yl PEQU_06390 14 RGSWSIEEDQKLVNFILNNGIQCWRHVPKLAGLMRCGKSCRLRWINYL 61 89********************************************97 PP | |||||||
2 | Myb_DNA-binding | 34 | 6.7e-11 | 67 | 153 | 1 | 46 |
TSSS-HHHHHHHHHHHHHTTTT..........................................-HHHHHHHHTTTS-HHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGgg..........................................tWktIartmgkgRtlkqcksrwqk 46 rg+ ++ E+e++++++ G++ +W++Ia++++ gRt++++k+ w++ PEQU_06390 67 RGALSEAEEEQIIQLHSNIGNRydkstiflvflktaatiehvfnlnrnknkilktkinvhvfnrRWSKIASYFP-GRTDNEIKNIWNT 153 78889*********************************************************************.*********9985 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 8.9E-21 | 5 | 64 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 20.928 | 9 | 65 | IPR017930 | Myb domain |
SMART | SM00717 | 4.1E-7 | 13 | 63 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 8.1E-12 | 14 | 61 | IPR001005 | SANT/Myb domain |
SuperFamily | SSF46689 | 1.5E-20 | 14 | 65 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 8.63E-6 | 16 | 61 | No hit | No description |
PROSITE profile | PS50090 | 7.817 | 62 | 155 | IPR017877 | Myb-like domain |
Gene3D | G3DSA:1.10.10.60 | 9.5E-19 | 65 | 85 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 3.5E-6 | 66 | 157 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 4.3E-8 | 67 | 153 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 1.70E-4 | 117 | 153 | No hit | No description |
SuperFamily | SSF46689 | 1.5E-20 | 127 | 156 | IPR009057 | Homeodomain-like |
Gene3D | G3DSA:1.10.10.60 | 9.5E-19 | 129 | 159 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 166 aa Download sequence Send to blast |
MGRQPCCDKE VVKRGSWSIE EDQKLVNFIL NNGIQCWRHV PKLAGLMRCG KSCRLRWINY 60 LRPDLKRGAL SEAEEEQIIQ LHSNIGNRYD KSTIFLVFLK TAATIEHVFN LNRNKNKILK 120 TKINVHVFNR RWSKIASYFP GRTDNEIKNI WNTKIKKKLR LQGLDP |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 153 | 159 | KIKKKLR |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Possible transcription activator. | |||||
UniProt | Transcription factor that acts as positive regulator of abscisic acid (ABA) signaling in response to salt stress. Acts as negative regulator ABI1, ABI2 and PP2CA, which are protein phosphatases 2C acting as negative regulator of ABA signaling. Binds to the DNA specific sequence and core element 5'-ACGT-3' found in the promoters of ABI1 and PP2CA to negatively regulate their expression during ABA-dependent salt stress response. {ECO:0000269|PubMed:23660402}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by salt stress, drought stress and abscisic acid (ABA). Down-regulated by salicylic acid (SA) methyl jasmonate (JA). {ECO:0000269|PubMed:23660402}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020571873.1 | 9e-79 | protein ODORANT1 | ||||
Swissprot | P80073 | 3e-54 | MYB2_PHYPA; Myb-related protein Pp2 | ||||
Swissprot | Q9C7U7 | 1e-55 | MYB20_ARATH; Transcription factor MYB20 | ||||
TrEMBL | A0A2G2XIP1 | 1e-63 | A0A2G2XIP1_CAPBA; Protein ODORANT1 | ||||
TrEMBL | M1AYB9 | 1e-63 | M1AYB9_SOLTU; Uncharacterized protein | ||||
STRING | PGSC0003DMT400032930 | 2e-64 | (Solanum tuberosum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP79 | 38 | 563 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G14340.1 | 5e-50 | myb domain protein 40 |
Publications ? help Back to Top | |||
---|---|---|---|
|