PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PEQU_05903
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Vandeae; Aeridinae; Phalaenopsis
Family MYB
Protein Properties Length: 288aa    MW: 32458.7 Da    PI: 5.441
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PEQU_05903genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.42.9e-171663148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT++Ed +l+ +++++G g+W++ ++  g+ R++k+c++rw +yl
       PEQU_05903 16 KGSWTPQEDIRLISYIRKHGHGNWRALPKQAGLLRCGKSCRLRWINYL 63
                     799*****************************99************97 PP

2Myb_DNA-binding51.52.4e-1669114148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T+eE++ +++++ +lG++ W++Ia++++ gRt++++k+ w+++l
       PEQU_05903  69 RGNFTKEEEDTIINLHGLLGNK-WSKIASCLP-GRTDNEIKNVWNTHL 114
                      89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.1E-24766IPR009057Homeodomain-like
PROSITE profilePS5129415.8191163IPR017930Myb domain
SuperFamilySSF466891.76E-3013110IPR009057Homeodomain-like
SMARTSM007175.9E-131565IPR001005SANT/Myb domain
PfamPF002494.1E-161663IPR001005SANT/Myb domain
CDDcd001674.54E-101863No hitNo description
PROSITE profilePS5129424.04464118IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.3E-2667118IPR009057Homeodomain-like
SMARTSM007172.1E-1468116IPR001005SANT/Myb domain
PfamPF002499.8E-1569114IPR001005SANT/Myb domain
CDDcd001675.78E-1071114No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 288 aa     Download sequence    Send to blast
MGRGRAPCCQ KIGLHKGSWT PQEDIRLISY IRKHGHGNWR ALPKQAGLLR CGKSCRLRWI  60
NYLRPDIKRG NFTKEEEDTI INLHGLLGNK WSKIASCLPG RTDNEIKNVW NTHLKKRVKH  120
ENYPTQSPEI IAAQPEAANK IVIPTEPQHD MWDILDSVLS PNLSPLAAPP VDDDDILIDI  180
PIEPELWSDA ANVGSVGEEA GMAGGRGLVD EGKNWLAYLE EELELFNEAE DERRMELVSM  240
EDGDLMRGYF HKRNSSPSSS SSSPSIPELV DFDCIDTWSL DKLSSRVR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-26141185108B-MYB
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that regulates positively genes involved in anthocyanin biosynthesis such as A1. {ECO:0000269|PubMed:7920701}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020574634.10.0myb-related protein Zm1-like
SwissprotP200242e-74MYB1_MAIZE; Myb-related protein Zm1
TrEMBLA0A2I0W3H21e-121A0A2I0W3H2_9ASPA; Myb-related protein Zm1
STRINGXP_008776690.14e-83(Phoenix dactylifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP21543798
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G23250.11e-66myb domain protein 15
Publications ? help Back to Top
  1. Franken P,Schrell S,Peterson PA,Saedler H,Wienand U
    Molecular analysis of protein domain function encoded by the myb-homologous maize genes C1, Zm 1 and Zm 38.
    Plant J., 1994. 6(1): p. 21-30
    [PMID:7920701]