PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | PEQU_04699 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Vandeae; Aeridinae; Phalaenopsis
|
||||||||
Family | ARR-B | ||||||||
Protein Properties | Length: 173aa MW: 19647.8 Da PI: 8.3474 | ||||||||
Description | ARR-B family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | G2-like | 72.1 | 8.4e-23 | 121 | 170 | 1 | 51 |
G2-like 1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQ 51 kpr+ W+peLH +F++ v+qL G+ +A Pk+il+++++ gLt+e+v+SHLQ PEQU_04699 121 KPRVTWSPELHVKFINIVNQL-GISRAAPKKILDMLNISGLTRENVASHLQ 170 79*******************.***************************** PP | |||||||
2 | Response_reg | 31.3 | 1e-11 | 1 | 55 | 53 | 108 |
CTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHHTTESEEEESS--HHHHH CS Response_reg 53 mpgmdGlellkeireeepklpiivvtahgeeedalealkaGakdflsKpfdpeelv 108 mp+mdG++ll+ i e++lp+i+++ + + + + + Ga d+l+Kp+ eel PEQU_04699 1 MPDMDGFKLLE-IVGLEMDLPVIMLSVDCDVKNVMKGIMHGAVDYLAKPVRLEELK 55 9*********7.5556679*********************************9996 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF52172 | 4.98E-15 | 1 | 70 | IPR011006 | CheY-like superfamily |
CDD | cd00156 | 1.89E-12 | 1 | 61 | No hit | No description |
Pfam | PF00072 | 7.8E-9 | 1 | 55 | IPR001789 | Signal transduction response regulator, receiver domain |
Gene3D | G3DSA:3.40.50.2300 | 3.3E-19 | 1 | 87 | No hit | No description |
PROSITE profile | PS50110 | 22.536 | 1 | 62 | IPR001789 | Signal transduction response regulator, receiver domain |
PROSITE profile | PS51294 | 9.541 | 118 | 173 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 2.33E-13 | 119 | 170 | IPR009057 | Homeodomain-like |
Gene3D | G3DSA:1.10.10.60 | 2.8E-21 | 119 | 170 | IPR009057 | Homeodomain-like |
TIGRFAMs | TIGR01557 | 1.3E-18 | 121 | 171 | IPR006447 | Myb domain, plants |
Pfam | PF00249 | 4.5E-6 | 123 | 170 | IPR001005 | SANT/Myb domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0000160 | Biological Process | phosphorelay signal transduction system | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 173 aa Download sequence Send to blast |
MPDMDGFKLL EIVGLEMDLP VIMLSVDCDV KNVMKGIMHG AVDYLAKPVR LEELKLIWKH 60 VVRRSLNEKK DQNVTNKQLG HATKSEEDQK LRHTKKCKGH NKESDNEVCA DSDEDMNPQK 120 KPRVTWSPEL HVKFINIVNQ LGISRAAPKK ILDMLNISGL TRENVASHLQ VCS |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1irz_A | 1e-18 | 117 | 170 | 1 | 54 | ARR10-B |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional activator that binds specific DNA sequence. Functions as a response regulator involved in His-to-Asp phosphorelay signal transduction system. Phosphorylation of the Asp residue in the receiver domain activates the ability of the protein to promote the transcription of target genes. May directly activate some type-A response regulators in response to cytokinins. {ECO:0000250|UniProtKB:Q940D0}. | |||||
UniProt | Transcriptional activator that binds specific DNA sequence. Functions as a response regulator involved in His-to-Asp phosphorelay signal transduction system. Phosphorylation of the Asp residue in the receiver domain activates the ability of the protein to promote the transcription of target genes. May directly activate some type-A response regulators in response to cytokinins. {ECO:0000250|UniProtKB:Q940D0}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020578712.1 | 1e-121 | two-component response regulator ORR23-like isoform X1 | ||||
Refseq | XP_020578714.1 | 1e-121 | two-component response regulator ARR18-like isoform X3 | ||||
Refseq | XP_020578715.1 | 1e-121 | two-component response regulator ARR18-like isoform X4 | ||||
Refseq | XP_020578716.1 | 1e-121 | two-component response regulator ARR18-like isoform X4 | ||||
Refseq | XP_020578717.1 | 1e-122 | two-component response regulator ARR18-like isoform X5 | ||||
Swissprot | B8AEH1 | 3e-55 | ORR23_ORYSI; Two-component response regulator ORR23 | ||||
Swissprot | Q6K8X6 | 3e-55 | ORR23_ORYSJ; Two-component response regulator ORR23 | ||||
TrEMBL | A0A2I0W9B1 | 3e-96 | A0A2I0W9B1_9ASPA; Two-component response regulator ARR10 | ||||
STRING | EOY29602 | 1e-57 | (Theobroma cacao) | ||||
STRING | evm.model.supercontig_127.10 | 4e-59 | (Carica papaya) | ||||
STRING | GSMUA_Achr10P23650_001 | 2e-58 | (Musa acuminata) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP11222 | 27 | 41 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G16110.1 | 7e-53 | response regulator 2 |
Publications ? help Back to Top | |||
---|---|---|---|
|