PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | PEQU_04570 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Vandeae; Aeridinae; Phalaenopsis
|
||||||||
Family | bZIP | ||||||||
Protein Properties | Length: 175aa MW: 19612.3 Da PI: 10.3161 | ||||||||
Description | bZIP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | bZIP_1 | 44.2 | 4e-14 | 1 | 52 | 10 | 61 |
HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 10 kqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklks 61 + +NRe+ArrsR++K+a + eLe+ v++L eN++L k+l +++++ + + PEQU_04570 1 MLSNRESARRSRRKKQAHLSELETQVAQLRVENSSLLKRLTDINQKYNEAVM 52 579***********************************99999999887655 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.20.5.170 | 1.3E-10 | 1 | 47 | No hit | No description |
CDD | cd14702 | 2.68E-18 | 1 | 48 | No hit | No description |
PROSITE profile | PS50217 | 9.979 | 1 | 49 | IPR004827 | Basic-leucine zipper domain |
SuperFamily | SSF57959 | 3.69E-10 | 1 | 47 | No hit | No description |
Pfam | PF00170 | 2.0E-11 | 1 | 49 | IPR004827 | Basic-leucine zipper domain |
SMART | SM00338 | 3.4E-10 | 1 | 56 | IPR004827 | Basic-leucine zipper domain |
Pfam | PF12498 | 1.0E-19 | 63 | 156 | IPR020983 | Basic leucine-zipper, C-terminal |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0071215 | Biological Process | cellular response to abscisic acid stimulus | ||||
GO:0071333 | Biological Process | cellular response to glucose stimulus | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0042802 | Molecular Function | identical protein binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 175 aa Download sequence Send to blast |
MLSNRESARR SRRKKQAHLS ELETQVAQLR VENSSLLKRL TDINQKYNEA VMENRILKTN 60 VETLRAKVKM AEDLVKRVTT AASFVSSPSE ISSAAAVPIQ DDPNVRSIAP LVHQGINSYL 120 PEATSAAPYT GKMYRTAPMQ RVASLEHLQK RICTGTNSFG SIHWDTVNFC NQNQI |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional activator that binds to the DNA specific sequence 5'-GCCACGT[AC]AG-3' found in the alpha-globulin gene promoter (PubMed:9049271, PubMed:11572990). Does not bind to promoters of other major storage genes such as glutelin, prolamin and albumin (PubMed:9049271). Binds to the DNA specific sequence 5'-TGAGTCA-3' found in seed storage protein gene promoters (PubMed:11133985). {ECO:0000269|PubMed:11133985, ECO:0000269|PubMed:11572990, ECO:0000269|PubMed:9049271}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00040 | PBM | Transfer from AT5G28770 | Download |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020578357.1 | 1e-106 | basic leucine zipper 63-like isoform X2 | ||||
Swissprot | Q7X9A8 | 1e-48 | RSBZ2_ORYSJ; bZIP transcription factor RISBZ2 | ||||
TrEMBL | A0A2I0B6A7 | 3e-64 | A0A2I0B6A7_9ASPA; Light-inducible protein CPRF2 | ||||
STRING | XP_010274216.1 | 4e-51 | (Nelumbo nucifera) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP3488 | 38 | 78 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G28770.1 | 2e-36 | bZIP family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|