PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PEQU_03213
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Vandeae; Aeridinae; Phalaenopsis
Family MYB
Protein Properties Length: 267aa    MW: 30476.9 Da    PI: 6.0521
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PEQU_03213genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding49.69.3e-16552148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W++eEde+l++++ ++G g+W+ ++ + g+ R +k+c++rw +yl
       PEQU_03213  5 KGLWSPEEDERLKNYIVRHGHGCWTEVPVKAGLERNGKSCRLRWINYL 52
                     678*******************************************97 PP

2Myb_DNA-binding58.51.5e-1858103148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rgr+++eE+el  +++++lG++ W+ Ia +++ gRt++++k++w++yl
       PEQU_03213  58 RGRFSQEEEELAMKLHTMLGNK-WSQIAMHLP-GRTDNEVKNYWNTYL 103
                      89********************.*********.*************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.233152IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.6E-21255IPR009057Homeodomain-like
SuperFamilySSF466891.65E-28399IPR009057Homeodomain-like
SMARTSM007175.8E-12454IPR001005SANT/Myb domain
PfamPF002492.0E-13552IPR001005SANT/Myb domain
CDDcd001679.41E-9852No hitNo description
PROSITE profilePS5129425.53153107IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.5E-2556107IPR009057Homeodomain-like
SMARTSM007173.5E-1657105IPR001005SANT/Myb domain
PfamPF002491.9E-1558103IPR001005SANT/Myb domain
CDDcd001673.24E-1060103No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 267 aa     Download sequence    Send to blast
MKCKKGLWSP EEDERLKNYI VRHGHGCWTE VPVKAGLERN GKSCRLRWIN YLRPGIKRGR  60
FSQEEEELAM KLHTMLGNKW SQIAMHLPGR TDNEVKNYWN TYLKKRVKLS KESDSAKLTE  120
NSAADSSSEN HKNREGNLKK ISFFDSFEPL ESSSQSHAIH SQEKQRNLWP KVMFADWILG  180
ENSNGQLGLE SSDGVNGLTW DSCSFDSRET INNGDLRAMS DHQEFGEDGS YVSCFETMDL  240
VGDDQSFDLS SFGGSFGGFE LNHDLMF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-2351077108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020572557.10.0transcription factor LAF1-like
TrEMBLA0A2I0VI461e-141A0A2I0VI46_9ASPA; Transcription factor LAF1
STRINGXP_008794566.19e-69(Phoenix dactylifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP170737109
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G52260.13e-56myb domain protein 19