PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | PEQU_00208 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Vandeae; Aeridinae; Phalaenopsis
|
||||||||
Family | GRAS | ||||||||
Protein Properties | Length: 142aa MW: 16177.7 Da PI: 8.87 | ||||||||
Description | GRAS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | GRAS | 179.4 | 2.5e-55 | 1 | 141 | 234 | 373 |
GRAS 234 lsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsek 332 ++P vv+v+e+ea+h+s+ Fl+rf+eal yysa+f+slea+lp+ s+er++vEr+++grei+++va eg+ rrerhe++e+W+ +++aGF pls + PEQU_00208 1 MNPAVVTVAEKEAKHSSPLFLQRFAEALGYYSAVFESLEATLPPSSRERMVVERMWIGREIEDIVAGEGEGRRERHERFERWEGLMKDAGFVVKPLSGF 99 69************************************************************************************************* PP GRAS 333 aakqaklllrkvk.sdgyrveeesgslvlgWkdrpLvsvSaW 373 a +qa+lllr ++ s+gyrve +gsl+lgWk++pL++vSaW PEQU_00208 100 ALAQARLLLRLHYpSEGYRVEMMKGSLFLGWKGKPLYAVSAW 141 ****************************************** PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF03514 | 8.8E-53 | 1 | 141 | IPR005202 | Transcription factor GRAS |
PROSITE profile | PS50985 | 25.428 | 1 | 121 | IPR005202 | Transcription factor GRAS |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 142 aa Download sequence Send to blast |
MNPAVVTVAE KEAKHSSPLF LQRFAEALGY YSAVFESLEA TLPPSSRERM VVERMWIGRE 60 IEDIVAGEGE GRRERHERFE RWEGLMKDAG FVVKPLSGFA LAQARLLLRL HYPSEGYRVE 120 MMKGSLFLGW KGKPLYAVSA WS |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5b3g_A | 8e-25 | 1 | 142 | 241 | 379 | Protein SCARECROW |
5b3h_A | 7e-25 | 1 | 142 | 240 | 378 | Protein SCARECROW |
5b3h_D | 7e-25 | 1 | 142 | 240 | 378 | Protein SCARECROW |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor required for axillary (lateral) shoot meristem formation during vegetative development. Seems to act upstream of REVOLUTA. {ECO:0000269|PubMed:12730136}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020600095.1 | 8e-99 | LOW QUALITY PROTEIN: scarecrow-like protein 18 | ||||
Swissprot | Q9ZWC5 | 7e-57 | SCL18_ARATH; Scarecrow-like protein 18 | ||||
TrEMBL | A0A2I0VKR7 | 2e-78 | A0A2I0VKR7_9ASPA; Scarecrow-like protein 18 | ||||
TrEMBL | A0A3G2CI50 | 9e-80 | A0A3G2CI50_CYMEN; Scarecrow-like protein 18-like transcript variant X2 (Fragment) | ||||
STRING | XP_008798776.1 | 2e-71 | (Phoenix dactylifera) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP3653 | 34 | 79 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G55580.1 | 1e-41 | GRAS family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|