PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | PDK_30s946431g005 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Coryphoideae; Phoeniceae; Phoenix
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 104aa MW: 11932.6 Da PI: 4.9337 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 175.5 | 5.1e-55 | 5 | 95 | 2 | 92 |
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyre 92 reqdrflPian++rim+k++P+n+ki+kdake+vqecvsefisf+tseasdkcqrekrktingddllwa++tlGfedyveplk+yl+ yre PDK_30s946431g005 5 REQDRFLPIANIGRIMRKAIPENGKIAKDAKESVQECVSEFISFITSEASDKCQREKRKTINGDDLLWAMGTLGFEDYVEPLKLYLQLYRE 95 89****************************************************************************************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 4.3E-50 | 4 | 96 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 3.88E-38 | 7 | 96 | IPR009072 | Histone-fold |
Pfam | PF00808 | 7.2E-29 | 10 | 74 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 6.3E-21 | 38 | 56 | No hit | No description |
PROSITE pattern | PS00685 | 0 | 41 | 57 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
PRINTS | PR00615 | 6.3E-21 | 57 | 75 | No hit | No description |
PRINTS | PR00615 | 6.3E-21 | 76 | 94 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 104 aa Download sequence Send to blast |
MADSREQDRF LPIANIGRIM RKAIPENGKI AKDAKESVQE CVSEFISFIT SEASDKCQRE 60 KRKTINGDDL LWAMGTLGFE DYVEPLKLYL QLYREDLRSP GMNT |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1n1j_A | 3e-49 | 5 | 95 | 3 | 93 | NF-YB |
4awl_B | 2e-49 | 5 | 95 | 4 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
4csr_A | 2e-49 | 5 | 95 | 4 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_008791403.1 | 3e-63 | nuclear transcription factor Y subunit B-4-like isoform X1 | ||||
Refseq | XP_008791404.1 | 2e-63 | nuclear transcription factor Y subunit B-4-like isoform X2 | ||||
Refseq | XP_008791405.1 | 3e-63 | nuclear transcription factor Y subunit B-4-like isoform X3 | ||||
Swissprot | P25209 | 3e-58 | NFYB_MAIZE; Nuclear transcription factor Y subunit B | ||||
TrEMBL | A0A2H3Y033 | 7e-62 | A0A2H3Y033_PHODC; nuclear transcription factor Y subunit B-4-like isoform X1 | ||||
TrEMBL | A0A2H3Y041 | 5e-62 | A0A2H3Y041_PHODC; nuclear transcription factor Y subunit B-4-like isoform X2 | ||||
TrEMBL | A0A2H3Y0L0 | 6e-62 | A0A2H3Y0L0_PHODC; nuclear transcription factor Y subunit B-4-like isoform X3 | ||||
STRING | XP_008791402.1 | 1e-62 | (Phoenix dactylifera) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP201 | 38 | 331 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G14540.1 | 8e-59 | nuclear factor Y, subunit B3 |
Publications ? help Back to Top | |||
---|---|---|---|
|