PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | PDK_30s901171g003 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Coryphoideae; Phoeniceae; Phoenix
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 181aa MW: 20775.8 Da PI: 10.0033 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 57 | 4.4e-18 | 14 | 61 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT+eEd +l+ +++++G+g+Wk+++ g+ R+ k+c++rw +yl PDK_30s901171g003 14 KGPWTPEEDIILISYIQEHGPGNWKSVPTNTGLMRCSKSCRLRWTNYL 61 79********************************************97 PP | |||||||
2 | Myb_DNA-binding | 29.4 | 1.8e-09 | 71 | 97 | 20 | 48 |
TTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 20 GggtWktIartmgkgRtlkqcksrwqkyl 48 + W++Ia++++ +Rt++++k++w+++l PDK_30s901171g003 71 KER-WAAIASYLP-RRTDNDIKNYWNTHL 97 556.*********.************996 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 1.8E-23 | 5 | 68 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 26.002 | 9 | 65 | IPR017930 | Myb domain |
SMART | SM00717 | 7.9E-14 | 13 | 63 | IPR001005 | SANT/Myb domain |
SuperFamily | SSF46689 | 1.57E-24 | 14 | 98 | IPR009057 | Homeodomain-like |
Pfam | PF00249 | 7.3E-17 | 14 | 61 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 1.69E-11 | 16 | 61 | No hit | No description |
PROSITE profile | PS50090 | 6.586 | 64 | 97 | IPR017877 | Myb-like domain |
SMART | SM00717 | 4.1 | 67 | 99 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 6.7E-8 | 70 | 97 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.7E-13 | 72 | 107 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 181 aa Download sequence Send to blast |
MGRPPCCDKV DIKKGPWTPE EDIILISYIQ EHGPGNWKSV PTNTGLMRCS KSCRLRWTNY 60 LRPGIKQALL KERWAAIASY LPRRTDNDIK NYWNTHLKKK IKKDQTTIGS YMAPSDSTIT 120 CHELIAKGYN SETRNSDIST IHFPLPRSSH SSSTYASSAE NISRLLEGWM RSCPKRERTL 180 F |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1h8a_C | 1e-18 | 11 | 101 | 24 | 128 | MYB TRANSFORMING PROTEIN |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor involved in the regulation of gene (e.g. drought-regulated and flavonoid biosynthetic genes) expression and stomatal movements leading to negative regulation of responses to drought and responses to other physiological stimuli (e.g. light). {ECO:0000269|PubMed:22018045}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Repressed by abscisic acid (ABA) and osmotic stress (salt stress). {ECO:0000269|PubMed:22018045}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_008792495.1 | 1e-113 | myb-related protein 306 | ||||
Swissprot | B3VTV7 | 1e-82 | MYB60_VITVI; Transcription factor MYB60 | ||||
TrEMBL | A0A2H3Y2N1 | 1e-112 | A0A2H3Y2N1_PHODC; myb-related protein 306 | ||||
STRING | XP_008792495.1 | 1e-113 | (Phoenix dactylifera) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP229 | 38 | 296 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G08810.1 | 9e-67 | myb domain protein 60 |
Publications ? help Back to Top | |||
---|---|---|---|
|