PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PDK_30s837411g011
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Coryphoideae; Phoeniceae; Phoenix
Family MYB
Protein Properties Length: 292aa    MW: 32327.2 Da    PI: 6.5109
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PDK_30s837411g011genomePDKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding48.32.4e-151562148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
    Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                       +g W++eEd++l d++ ++G  +W++++ + g+ R +k+c++rw +yl
  PDK_30s837411g011 15 KGLWSPEEDQKLRDYILKHGHSCWSAVPIKAGLQRNGKSCRLRWINYL 62
                       678*******************************************97 PP

2Myb_DNA-binding53.36.4e-1768113148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
    Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                        rg +++eE+e+ +++ ++lG++ W+ Ia +++ gRt++++k++w++yl
  PDK_30s837411g011  68 RGIFSQEEEEIVINLQARLGNK-WSQIAMHLP-GRTDNEVKNYWNSYL 113
                        6889******************.*********.*************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.1781062IPR017930Myb domain
SuperFamilySSF466895.62E-2812109IPR009057Homeodomain-like
SMARTSM007173.9E-111464IPR001005SANT/Myb domain
PfamPF002499.4E-141562IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.4E-221669IPR009057Homeodomain-like
CDDcd001674.93E-101862No hitNo description
PROSITE profilePS5129425.68763117IPR017930Myb domain
SMARTSM007174.6E-1667115IPR001005SANT/Myb domain
PfamPF002491.2E-1468113IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.2E-2570117IPR009057Homeodomain-like
CDDcd001672.51E-1271113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009751Biological Processresponse to salicylic acid
GO:0010018Biological Processfar-red light signaling pathway
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 292 aa     Download sequence    Send to blast
MGCRTCEKPK VNYRKGLWSP EEDQKLRDYI LKHGHSCWSA VPIKAGLQRN GKSCRLRWIN  60
YLRPGLKRGI FSQEEEEIVI NLQARLGNKW SQIAMHLPGR TDNEVKNYWN SYLKKKVINA  120
QGSDPHGSAT KSLEPTNKNL LTQKETNNQI PSSQSLEPPE SSTADSGLSM KHSMEFGSFE  180
GAIHHHFPEV LIADWLSVDQ VIEQGSGIFG GATSTPWNSS NSNVDEVLRP GSSEVVGHSN  240
SDFLGGYGGT GIDGELQAQF EPVSPIPGDA FFDLFTMGKI PGSLDMNHEV IF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C6e-25911723128MYB TRANSFORMING PROTEIN
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008780142.10.0transcription repressor MYB6-like
TrEMBLA0A2H3X8V00.0A0A2H3X8V0_PHODC; transcription repressor MYB6-like
STRINGXP_008780142.10.0(Phoenix dactylifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP170737109
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G25560.11e-57myb domain protein 18