PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PDK_30s835131g001
Organism
Phoenix dactylifera
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Coryphoideae; Phoeniceae; Phoenix
Family WRKY
Protein Properties Length: 182aa    MW: 20981.5 Da    PI: 9.9454
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PDK_30s835131g001genomePDKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY104.46e-33101159159
                        ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
               WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                        ldDgy+WrKYGqK vk+++fprsYYrCts+gC+vkk+++r ++d+ +v++tYeg H+h+
  PDK_30s835131g001 101 LDDGYRWRKYGQKAVKNNKFPRSYYRCTSQGCNVKKQIQRLSKDEGIVVTTYEGIHTHP 159
                        59********************************************************7 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.807.4E-3486159IPR003657WRKY domain
SuperFamilySSF1182901.96E-2993160IPR003657WRKY domain
PROSITE profilePS5081130.28596161IPR003657WRKY domain
SMARTSM007749.1E-39101160IPR003657WRKY domain
PfamPF031062.3E-26102159IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 182 aa     Download sequence    Send to blast
MENYPTVLFP LQPSSYSSQL PHLSSNMLGN TQVFGLHDYN SGGHLGLKEE VKVSSSEGHE  60
ASHRESFGGP ENEAKPHKKK GEKKVRRRRY AFQTRSQVDI LDDGYRWRKY GQKAVKNNKF  120
PRSYYRCTSQ GCNVKKQIQR LSKDEGIVVT TYEGIHTHPI EKSNDSFEHI LNQMQVYSTF  180
RV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A9e-2891160776Probable WRKY transcription factor 4
2lex_A9e-2891160776Probable WRKY transcription factor 4
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008808114.11e-135probable WRKY transcription factor 75
SwissprotQ9FYA21e-54WRK75_ARATH; Probable WRKY transcription factor 75
TrEMBLA0A2H3Z4631e-134A0A2H3Z463_PHODC; probable WRKY transcription factor 75
STRINGXP_008808114.11e-135(Phoenix dactylifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP110038133
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G13080.18e-56WRKY DNA-binding protein 75
Publications ? help Back to Top
  1. Brand LH,Kirchler T,Hummel S,Chaban C,Wanke D
    DPI-ELISA: a fast and versatile method to specify the binding of plant transcription factors to DNA in vitro.
    Plant Methods, 2010. 6: p. 25
    [PMID:21108821]
  2. Xu L, et al.
    Overexpression of GbWRKY1 positively regulates the Pi starvation response by alteration of auxin sensitivity in Arabidopsis.
    Plant Cell Rep., 2012. 31(12): p. 2177-88
    [PMID:22890372]
  3. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  4. Schmiesing A,Emonet A,Gouhier-Darimont C,Reymond P
    Arabidopsis MYC Transcription Factors Are the Target of Hormonal Salicylic Acid/Jasmonic Acid Cross Talk in Response to Pieris brassicae Egg Extract.
    Plant Physiol., 2016. 170(4): p. 2432-43
    [PMID:26884488]
  5. Velasco VM, et al.
    Acclimation of the crucifer Eutrema salsugineum to phosphate limitation is associated with constitutively high expression of phosphate-starvation genes.
    Plant Cell Environ., 2016. 39(8): p. 1818-34
    [PMID:27038434]
  6. Hossain MA, et al.
    Identification of Novel Components of the Unfolded Protein Response in Arabidopsis.
    Front Plant Sci, 2016. 7: p. 650
    [PMID:27242851]
  7. Zhang H,Huang L,Hong Y,Song F
    BOTRYTIS-INDUCED KINASE1, a plasma membrane-localized receptor-like protein kinase, is a negative regulator of phosphate homeostasis in Arabidopsis thaliana.
    BMC Plant Biol., 2016. 16(1): p. 152
    [PMID:27389008]
  8. Zhang S, et al.
    The Arabidopsis Mitochondrial Protease FtSH4 Is Involved in Leaf Senescence via Regulation of WRKY-Dependent Salicylic Acid Accumulation and Signaling.
    Plant Physiol., 2017. 173(4): p. 2294-2307
    [PMID:28250067]
  9. Guo P, et al.
    A Tripartite Amplification Loop Involving the Transcription Factor WRKY75, Salicylic Acid, and Reactive Oxygen Species Accelerates Leaf Senescence.
    Plant Cell, 2017. 29(11): p. 2854-2870
    [PMID:29061866]
  10. Zhang L,Chen L,Yu D
    Transcription Factor WRKY75 Interacts with DELLA Proteins to Affect Flowering.
    Plant Physiol., 2018. 176(1): p. 790-803
    [PMID:29133369]