PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PDK_30s812061g001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Coryphoideae; Phoeniceae; Phoenix
Family MYB_related
Protein Properties Length: 364aa    MW: 40045.8 Da    PI: 4.9735
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PDK_30s812061g001genomePDKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding44.92.6e-142265146
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
    Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
                       rg+++++E++l++++++ lG++ W+ Ia+ ++ gRt++++k+ w++
  PDK_30s812061g001 22 RGSFSQQEEDLIIELHAVLGNR-WSQIAAQLP-GRTDNEIKNLWNS 65
                       899*******************.*********.*********9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500904.31116IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.601.3E-10228IPR009057Homeodomain-like
SuperFamilySSF466891.45E-20376IPR009057Homeodomain-like
PROSITE profilePS5129424.7251771IPR017930Myb domain
SMARTSM007172.0E-122169IPR001005SANT/Myb domain
PfamPF002493.2E-132265IPR001005SANT/Myb domain
CDDcd001672.38E-92464No hitNo description
Gene3DG3DSA:1.10.10.603.1E-202967IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 364 aa     Download sequence    Send to blast
LQRCGKSCRL RWINYLRPDL KRGSFSQQEE DLIIELHAVL GNRWSQIAAQ LPGRTDNEIK  60
NLWNSCIKKK LRQRGIDPNT HKPLSETEGG EDKVPANEDK TAGSSELKLL APPSGNLNSV  120
VPELAPPLMS MVDGSNSENL VASTKDFFLY RFAAGHESSS GCQPTNSMDY LPPRNSVYSP  180
SSSMDQNPPL WFNQNARLLD MNPELTCNMM MSAALPSVSR STVSTSMGLK PTARMAADNS  240
LPGFHCLEAG NSSNNSASSG NSGGGIEPQS NNSIYESSIF QWPELVPNRQ AEIQLGGEPE  300
DLKWSEYLNG TIPLSADIQN QTQLLNGAVK EENQFPIDGL SSWLQPPELF GKDFQRISTV  360
FKQI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-2237140108B-MYB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008807932.10.0transcription factor MYB61-like
TrEMBLA0A2H3Z3R00.0A0A2H3Z3R0_PHODC; transcription factor MYB61-like
STRINGXP_008807932.10.0(Phoenix dactylifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23103794
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G01680.36e-54myb domain protein 55