PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | PDK_30s763941g003 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Coryphoideae; Phoeniceae; Phoenix
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 155aa MW: 16966.1 Da PI: 5.9854 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 180.5 | 1.4e-56 | 21 | 113 | 1 | 93 |
NF-YB 1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyre 92 vreqdr+lPian+srimkk+lPan+ki+kdaket+qecvsefisfvtseasdkcqrekrktingddllwa+atlGfedyv+plk+yl+kyre PDK_30s763941g003 21 VREQDRLLPIANISRIMKKALPANGKIAKDAKETIQECVSEFISFVTSEASDKCQREKRKTINGDDLLWAMATLGFEDYVDPLKLYLQKYRE 112 69*****************************************************************************************9 PP NF-YB 93 l 93 PDK_30s763941g003 113 G 113 5 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 7.2E-54 | 16 | 122 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 2.02E-39 | 24 | 115 | IPR009072 | Histone-fold |
Pfam | PF00808 | 2.7E-28 | 27 | 91 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 3.0E-22 | 55 | 73 | No hit | No description |
PROSITE pattern | PS00685 | 0 | 58 | 74 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
PRINTS | PR00615 | 3.0E-22 | 74 | 92 | No hit | No description |
PRINTS | PR00615 | 3.0E-22 | 93 | 111 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 155 aa Download sequence Send to blast |
MGVGMDLGHE SGGDQSPRSN VREQDRLLPI ANISRIMKKA LPANGKIAKD AKETIQECVS 60 EFISFVTSEA SDKCQREKRK TINGDDLLWA MATLGFEDYV DPLKLYLQKY REGDSKLSAK 120 GGDGSVKKEG GGVQGRTQVG TSTQGEYQVS FFDLL |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4awl_B | 7e-49 | 20 | 112 | 2 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
4csr_A | 7e-49 | 20 | 112 | 2 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_008792219.1 | 5e-94 | nuclear transcription factor Y subunit B-like | ||||
Refseq | XP_008792227.1 | 5e-94 | nuclear transcription factor Y subunit B-like | ||||
Refseq | XP_008792234.1 | 5e-94 | nuclear transcription factor Y subunit B-like | ||||
Refseq | XP_008792242.1 | 5e-94 | nuclear transcription factor Y subunit B-like | ||||
Swissprot | Q8VYK4 | 2e-72 | NFYB8_ARATH; Nuclear transcription factor Y subunit B-8 | ||||
TrEMBL | A0A2H3Y216 | 1e-92 | A0A2H3Y216_PHODC; nuclear transcription factor Y subunit B-like | ||||
STRING | XP_008792219.1 | 2e-93 | (Phoenix dactylifera) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP201 | 38 | 331 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G37060.3 | 1e-68 | nuclear factor Y, subunit B8 |
Publications ? help Back to Top | |||
---|---|---|---|
|